KEGG   Rhizobium etli CFN 42: RHE_CH03995Help
Entry
RHE_CH03995       CDS       T00317                                 

Gene name
dppDch3
Definition
(GenBank) dipeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHE_CH03995 (dppDch3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ret02000]
    RHE_CH03995 (dppDch3)
Transporters [BR:ret02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RHE_CH03995 (dppDch3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N AAA_22
Motif
Other DBs
NCBI-ProteinID: ABC92739
RhizoBase: RHE_CH03995
UniProt: Q2K347
LinkDB All DBs
Position
4220526..4221359
Genome map
AA seq 277 aa AA seqDB search
MTTLLTVDRLKVSYPTRTGVIEAVRGVSLTLGRERLGIVGESGSGKSQTGRAIMGLTPKH
GIVTADRLDFSGIDLLKASVGERRRLRGKRIAMILQDPKYSLDPVMTIGRQICETLRTHE
KIAKAEARERALAMLEAVQIRDPQRVFDLYPHEVSGGMGQRAMIAMMLIAGPELLIADEP
TSALDVTVQLDVLRIMDRLVAERGMGLIFVSHDLRLVSSFCDRVIVMYAGKIVEELAAAD
LKHAQHPYTRGLLNCMPEIGANRHPLPVLDRKPEWAA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcttctgacggtcgacaggctcaaggtcagttatcccacccgcaccggcgtg
atcgaggccgtgcgcggcgtctccctcacgctcggccgggaaaggctcggtattgtcggc
gaatccggctccggcaagtcgcagaccggccgggcgatcatggggctgacgccgaaacac
gggatcgtcacggccgacaggctcgatttcagcggcatcgatctcctcaaggcatccgtc
ggagaaaggcgcaggctgcgcggcaagcgcatcgctatgatcctgcaggatccgaaatat
tcgctcgaccccgtcatgacgatcggacggcagatctgcgaaacgctgcgcacgcatgag
aagatcgccaaagcggaagcgcgcgaacgggcgctcgccatgctggaagcggttcagatc
cgcgatcctcagcgggtctttgacctgtatccgcatgaggtttcgggcggcatgggacag
cgcgccatgatcgccatgatgctgattgccggacccgaactgctgattgccgacgaaccc
acttcggcgctcgacgtgacggtgcagctcgatgtgctccgcatcatggacaggctggtc
gctgagcgcggcatggggctgatcttcgtctcccatgatctgagactggtctcttccttc
tgcgaccgggtcattgtcatgtatgccggcaagatcgtcgaagagctcgcggccgccgat
ctcaaacatgcgcagcatccctatacgcggggactgctgaactgcatgccggagatcggg
gcgaaccgccatccgctgccggtgctcgaccgcaagccggagtgggcggcatga

DBGET integrated database retrieval system