KEGG   Rhizobium etli CFN 42: RHE_PB00129Help
Entry
RHE_PB00129       CDS       T00317                                 

Definition
(GenBank) probable oligopeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ret00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RHE_PB00129
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ret02000]
    RHE_PB00129
Transporters [BR:ret02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    RHE_PB00129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 Mg_chelatase AAA_16 AAA_5 AAA_25 NACHT DUF87 Sigma54_activat RsgA_GTPase MMR_HSR1 AAA_28 AAA_24 NTPase_1 AAA_18 AAA_33 AAA_23 FtsK_SpoIIIE IstB_IS21 AAA CbiA AAA_15
Motif
Other DBs
NCBI-ProteinID: ABC93171
UNAM_b: RE1PB0000129
RhizoBase: RHE_PB00129
UniProt: Q2K258
LinkDB All DBs
Position
p42b:145091..145885
Genome map
AA seq 264 aa AA seqDB search
MSATFCSLRQLSITYGHGRSNAAALEHINLDIATGERLAIIGESGSGKSTLARALAGLLP
NGATVAGEIVWPALGHRPRPGRDFGFVFQDPGASLNPVLTIGEQIAEGARHHLGLSWKQA
SSKAEELLDRVGIPQPGKAMRAYPHQLSGGQRQRVAIAAAIAAKPALLIADEVTSALDVV
VQAQIVRLLDELVREDGMTLLFITHDIALASGFVDRIAVFHDAKLVEEGPVRSVLSAPQS
RHTAALIASHRDLATRPLIAEASS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgactttctgcagcctgcggcagctttcgatcacctatgggcacggccggagc
aatgcggcggcgctcgagcacatcaatctcgatattgccaccggcgaaaggctggcgatc
atcggcgaaagcggctccggcaagagcacgctcgcccgtgcgctcgccggtctgctgccg
aacggagcgacggtcgcaggcgaaattgtctggcccgctctcggccatcggcctcgtccg
ggccgcgatttcggcttcgtcttccaggatccgggcgccagcctcaatcccgtcctgacg
atcggcgagcagattgccgagggtgccaggcaccatctcgggctcagctggaaacaggcc
tccagcaaagccgaggaattgctcgaccgggtgggcataccgcagccgggtaaggcgatg
cgggcctatccgcaccagctttccggtggccagcgacagcgcgtggcgattgcagcggca
atcgcggcaaagcccgcgctgctgatcgccgacgaggtgacgagcgcgctcgatgtggtg
gtccaagctcagatcgtccggctgctcgacgagttggtgcgcgaggacggcatgacactg
cttttcatcacccacgacatcgcgctcgcctccggcttcgtcgaccggatcgccgtcttc
cacgatgcgaagctggtcgaggaggggccggtgcgttcagtgctttcggcgccccaaagc
cgccataccgccgcccttatcgccagccaccgcgaccttgcgacgcgaccgctgatcgcg
gaggcttcgtcatga

DBGET integrated database retrieval system