KEGG   Rhizobium etli CFN 42: RHE_PE00252Help
Entry
RHE_PE00252       CDS       T00317                                 

Definition
(GenBank) putative ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ret00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RHE_PE00252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ret03400]
    RHE_PE00252
Enzymes [BR:ret01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RHE_PE00252
DNA repair and recombination proteins [BR:ret03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RHE_PE00252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C CTK3_C
Motif
Other DBs
NCBI-ProteinID: ABC93687
UNAM_e: RE1PE0000252
RhizoBase: RHE_PE00252
UniProt: Q2K0P3
LinkDB All DBs
Position
p42e:complement(282101..284749)
Genome map
AA seq 882 aa AA seqDB search
MASDKLSSYRSKRDFQKTAEPSGERSLKQSNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGRKSPE
QALSKGDFKFTLEGERLHGSFVLVRMRNDRERSKRTNWLLIKHHDEFSVDENGASILEEN
VTSVASGRSMEMIAAGKGRKPKPFMVEGGKVQADAVWDSNHGLAAEERQSEASAGKRAGT
ATAVDLPDFIAPQLCEKVERPPGGDGWIHEIKFDGYRIQMRVLDGEVTLKTRKGLDWTAK
YPEIAEAASGLPDCILDGEICALDEQGAPNFAALQAALSEGKTASLVYFAFDLLYDGGED
LRSKPLIERKRRLQELLTEAGNDPRIRYVEHFETGGDAVLRSACKLSLEGIISKQTDAPY
QSGRTESWAKSKCRAGHEVVIGAYAKTNGRFRSLLAGVFRGDHFVYVGRVGTGYGAKKVE
TLLPKLKALETARSPFTGIGAPKKQAEVVWVKPELVAEIEFEGWTADGLVRQAAFKGLRE
DKPAREVEAEPPVRPAKADIAEPVPRARQTPARRKGAKADVMGVLISNPDKPLWPDANGS
EPVTKEELAGYYEAVGDWMIDHIKGRPCSIIRAPDGIGGEQFFQRHAMPGQSNLLDLVKV
FGDKKPYLQIDRIEGLAAVAQIAAVELHPWNCEPGQPEVPGRLVFDLDPGPDVPFATVVA
AAREMRDRLEDLGLISFCKTTGGKGLHVVTPLAVNKRKPLSWPEAKAFAHDVCQQMARNN
PDLYLIKMTKSLRGGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLDPK
RFTIRTVPALLSKSSAWKDYCEGQRPLEQAIKKLGRAGKHAA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaagctatcaagctatcgatcaaaacgcgattttcagaagaccgctgag
cccagcggcgagcggtccctcaaacagagcaaccgccgtcgctttgtcatccagaagcac
gatgcgacacgcctgcactacgacctgcggctcgagctcgatggcgtgttcaagagctgg
gccgtcaccaaagggccatcgctcgatccgcacgacaagcggctggcggtcgaggtcgag
gatcatcccctcgattatggcgacttcgaaggcactattccgaaaggccagtatggcggt
ggcacggtcatgctgtgggatcgcggctattgggagccggagggcaggaagagcccggag
caggcgctttccaagggtgatttcaagttcacgctcgaaggcgagcgcctgcacgggagc
ttcgtgctggtgcgcatgcgcaacgatcgcgagcgcagcaagcgtaccaattggctgttg
atcaagcatcacgacgagttctccgtggacgagaacggtgcttccatcctcgaagaaaac
gtcacctccgtggcctcaggccgcagcatggaaatgatcgcagccggcaaggggcgcaag
ccgaaacccttcatggtggagggcggcaaggtccaggcggacgccgtctgggacagcaat
cacggactggccgccgaggagcggcagtcggaggcgagcgcgggaaagcgcgccggtact
gcgacggcggttgatcttccggatttcatcgcgccgcaactctgcgagaaggtcgagcga
ccgcctggcggggacggttggatccatgagatcaagttcgatggatatcgcattcagatg
cgcgtgctcgatggcgaagtcaccttgaagaccaggaaaggcctcgactggacggccaag
taccccgaaatcgccgaggcggcgtctgggcttccggattgtatcctcgacggcgagatt
tgcgctctcgacgagcaaggtgcgcctaacttcgcggcactccaggcggcgctatcggag
ggcaagaccgccagcctcgtctacttcgccttcgacctgctctatgacggcggcgaggat
ctccgctcgaagcccctgatcgagcgaaagaggcgattgcaggagctcctcaccgaggcc
ggcaacgatcctcggatccgctacgtcgaacacttcgagaccggcggtgacgccgtcctc
agatcggcatgcaagctctcgctggaaggcatcatctcaaaacagacagatgccccctat
caatccggacgaacggaaagctgggcgaagtcgaaatgccgggcggggcacgaggtggtg
atcggcgcctacgccaaaaccaacggcaggtttcgttcccttctcgccggtgtttttcgc
ggcgatcattttgtctatgtcggccgtgtcggaaccggctacggcgccaagaaagtcgaa
acgttgcttccgaaactgaaggcgctggagacggcgagatcgcccttcacgggtatcggt
gctccgaagaagcaggccgaggtcgtctgggtaaagccggaacttgtcgccgaaatcgaa
ttcgaggggtggaccgcggacggtctcgtccgccaagcagccttcaaaggattgcgcgaa
gataagcctgctcgggaagtcgaggcggagccaccagtaagacccgccaaagcggacatc
gcggagccggttccgagagccaggcaaacaccggcgcgccgcaagggtgcgaaggctgat
gtcatgggagtgctcatctcaaacccggacaaaccattgtggccggatgccaacggcagc
gaaccggtcacgaaggaagaattggcgggctattacgaggcagtcggcgactggatgatc
gaccacatcaagggcaggccctgctctatcatccgcgccccggatggaattggcggcgag
cagttctttcagcgccatgcgatgccgggacaatcgaacctgctcgacctggtcaaggtg
ttcggggacaaaaagccatacctgcagatcgatcgcatcgaaggccttgccgcggtcgcc
cagatcgcagcggtcgaactccatccgtggaactgcgaacccggtcaaccggaagttcct
ggtcgtctggtattcgacctcgatcccgggcctgacgttccctttgccacggtcgttgcc
gctgcccgcgaaatgcgcgatcggctggaagacctcggactgatcagcttttgcaagacg
acgggcggcaagggcctgcatgtcgtgaccccgcttgcggtcaataagcgcaagccgctg
tcatggcccgaggcaaaggctttcgcgcatgacgtctgccagcagatggcccgaaacaac
cccgatctctaccttatcaagatgacgaagagcctgaggggcggtcgcattttcctcgat
tacctgcgcaatgatcgcatggcgacggccgtagcgccgctttctcctcgagcccgcccc
ggtgcgacggtatcaatgcctctgacgtggacgcaggtgaaatcagacctcgaccctaaa
aggttcacgatccgaaccgtacctgccttgctatcgaagtcgtccgcctggaaggattat
tgtgaggggcagcgtcccttggagcaggcgattaagaagctcggccgcgccggcaagcat
gccgcgtga

DBGET integrated database retrieval system