KEGG   Rhizobium etli CFN 42: RHE_PF00042Help
Entry
RHE_PF00042       CDS       T00317                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylaseoxygenase, large subunit protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00630  Glyoxylate and dicarboxylate metabolism
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_PF00042 (rbcL)
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RHE_PF00042 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABC93936
UNAM_f: RE1PF0000042
RhizoBase: RHE_PF00042
UniProt: Q2JZQ0
LinkDB All DBs
Position
p42f:complement(43019..44272)
Genome map
AA seq 417 aa AA seqDB search
MITLTYRIETPGSVETMADKIASDQSTGTFVPVPGETEELKSRVAARVLAIRPLENARHP
TWPESAPDTLLHRADVDIAFPLEAIGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPEAF
RSAHPGPQFGIAGSRRLTGVEGRPIIGTIVKPALGLRPHETAELVGELIGSGVDFIKDDE
KLMSPAYSPLKERVAAIMPRILDHEQKTGKKVMYAFGISHADPDEMMRNHDIVAAAGGNC
AVVNINSIGFGGMSFLRKRSSLVLHAHRNGWDVLTRDPGAGMDFKVYQQFWRLLGVDQFQ
INGIRIKYWEPDESFVSSFKAVSTPLFDAADCPLPVAGSGQWGGQAPETYERTGRTIDLL
YLCGGGIVSHPGGPAAGVRAVQQAWQAAVAGIPLEVYAKDHPELAASIAKFSDGKGA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgataaccctgacctaccgcatcgaaacgcccggcagcgtcgagacgatggcggacaag
atcgccagcgaccagtcgaccggaaccttcgtgccggttcccggcgagacggaagagctg
aaatcgcgcgtcgccgcccgggttttggcgatccgcccgctcgagaatgcgcgccatccg
acctggcccgagtccgcgcccgacacgctgctccaccgcgccgacgtcgacattgccttc
cctctggaggcgatcggcacagatctctcggcgctgatgaccatcgcgatcggcggcgtc
tattcgatcaagggcatgaccggcatccgcatcgtcgacatgaagctgcccgaagctttc
cggagcgcccatcccgggccgcaattcggcatagcgggcagccgccgcctcaccggcgtc
gagggccgcccgatcatcggcacgatcgtcaagccggcactggggctgaggccgcacgag
acggcggaactcgtcggcgaattgattgggtcgggcgtcgacttcatcaaggacgatgag
aagctgatgagcccggcctattcgccgctcaaggagcgcgtcgccgcgatcatgccgcgc
attctcgatcacgagcagaagaccggcaagaaggtcatgtatgccttcggcatctcgcat
gccgatcccgacgagatgatgcgcaaccacgatatcgtcgctgcggccggcggcaattgc
gccgtcgtcaatatcaattcgatcggcttcggcggcatgagcttcctgcgcaagcgctcc
agcctggtgctgcatgcgcatcgcaacggctgggatgtgctgacgcgcgatccgggcgcc
ggcatggatttcaaggtctatcagcagttctggcggctgctcggcgtcgaccagttccag
atcaacggcatcagaatcaaatattgggagccggacgagagcttcgtctcttccttcaag
gccgtcagcacgccgctcttcgatgccgccgattgcccgcttccggtcgcgggctccggc
cagtggggcgggcaggcgccggagacctacgagcgcaccggccgcaccatcgatcttctc
tatctctgcggcggcggcatcgtcagccatcccggcggtcctgctgccggcgtgcgcgcc
gtgcagcaggcctggcaggcggcggtcgccggcattccgctggaggtctatgccaaggat
catccggagcttgccgcctcgattgccaaattcagcgacggcaagggcgcgtga

DBGET integrated database retrieval system