KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0115
Entry
Reut_A0115        CDS       T00268                                 
Name
(GenBank) 3-oxoadipate enol-lactonase
  KO
K01055  3-oxoadipate enol-lactonase [EC:3.1.1.24]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0115
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     Reut_A0115
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Ser_hydrolase
Other DBs
NCBI-ProteinID: AAZ59497
UniProt: Q477D6
LinkDB
Position
1:142180..143028
AA seq 282 aa
MTASTAANTSGETHRIHADGADLHVRVDGADGPWVILAHALGANHTLWDATARHLSSRYR
VVRPDMRGHGNSDAPVGPYTMVRLADDVAAIMDALQIPQAHFCGISVGGMIGETLGVRHA
ERLLSLTLAATISRTPLEAHPMWHNRIGQVEAHGMSGLADATLERWLTEPFRNAHPDEVA
RIRAMLLATPVRGYVGVGQAIMAFDMASALGRIHCPTLVVAGEHDQGATVAMAKSIASAI
PGSRLEVLPAAHLVSVEQADRFHAALDTFLGHAACGGQCDVP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaccgccagcaccgcagccaacacatccggagagacgcatcgcatccacgccgatggc
gccgacctgcacgtccgcgtggatggcgccgacggcccgtgggtcatccttgcgcacgca
ctcggcgccaaccatacgctgtgggatgccacggcgcgccatctttcgtcgcgctatcgc
gtcgtgcgcccggacatgcgcggccatggcaacagcgatgcaccggtcgggccctacacg
atggtgcggctggccgacgatgtcgccgccatcatggacgcgctgcagataccgcaggcg
catttctgcggcatctcggtgggcggcatgatcggcgagacgctgggcgtgcgccatgcc
gaacggctgctatcgctgacgctcgcggccaccattagccgcacgccgctggaagcgcat
ccgatgtggcacaaccgcatcgggcaagtcgaagcgcatggcatgtcgggccttgcggat
gccacgctggagcgctggctgaccgagccattccgcaacgcgcatcccgacgaagtcgcg
cgcatccgcgcgatgctgctggccacgccggtacgcggctatgtcggcgtagggcaggcc
atcatggcgttcgacatggcaagcgccctgggccgcatccattgcccgacgctggtcgta
gcgggcgaacatgaccagggtgcgacagtcgccatggcgaagtccatcgcctcggcgatt
cctgggtctcggctggaagtcttgcctgcggcgcatctggtgtcggtcgaacaggcggat
cgcttccatgccgcgctggatacgttcctcggtcacgctgcctgcggcggccaatgcgac
gttccgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1692
Entry
Reut_A1692        CDS       T00268                                 
Name
(GenBank) 3-oxoadipate enol-lactonase
  KO
K01055  3-oxoadipate enol-lactonase [EC:3.1.1.24]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1692
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     Reut_A1692
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_4 UPF0227 Esterase
Other DBs
NCBI-ProteinID: AAZ61057
UniProt: Q470X6
LinkDB
Position
1:1825813..1826622
AA seq 269 aa
MTNPAYPARTGTAISAGVSIHYTIEGAAGAPVLVMSNSLGTTLQMWDPQMPALLRHFRVL
RYDTRGHGRSSVPAQPFSMAELGADVIAVMDDAGVERAQFCGLSMGGMTGMWLARHHANR
FDRFVLANTAALIGPASVWDNRIATVLRDGMAAIVPGVLERWFTSSYRASHAQAMEPVRD
MLLGCDPAGYTANCAAVRDADLRAIVPQIDASVLVIAGEQDAATTPAQGREVAQAVPGAE
YLSLDAAHLSNWELPQAFADAVVRFLKAA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaccaatcctgcttatcccgcccgcaccggcacggccatcagcgccggcgtttccatc
cactacacgatcgaaggcgccgccggcgcgccggtgctggtcatgtccaattcgctgggc
accacgctacagatgtgggacccgcagatgccggctttgctcaggcatttccgcgtgctg
cgctatgacacgcgcggtcatggccgctcgtcggtacctgcgcagccgttcagcatggcg
gaactcggtgcggacgtgatcgcggtgatggacgatgccggcgtcgaacgcgcccagttc
tgtgggctatcgatgggcggcatgaccggcatgtggctggcgcggcatcacgctaaccgc
ttcgatcgcttcgtgctggccaataccgccgcgctgattggcccggcctcggtgtgggac
aaccgcattgctaccgtgctgcgtgatggcatggcggctatcgttccgggcgtgctggag
cgctggttcacgtcgtcttaccgcgcgtcgcacgcacaagccatggagcccgtgcgcgac
atgctgctcggctgcgatcccgcaggctataccgccaactgcgccgccgtgcgagatgcc
gacctgcgcgccatcgtgccgcagatcgatgccagcgtgctggtcatcgccggcgagcag
gatgccgctaccacgcccgcgcaaggccgtgaagtcgcgcaggccgtgccgggcgcggaa
tacctgtcgctcgacgcagcgcacctgtcgaactgggagctgccgcaagcgttcgcggat
gccgtggtgaggtttctcaaggcagcgtaa

DBGET integrated database retrieval system