KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0763Help
Entry
Reut_A0763        CDS       T00268                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Reut_A0763
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:reu02000]
    Reut_A0763
Enzymes [BR:reu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Reut_A0763
Transporters [BR:reu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Reut_A0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_4
Motif
Other DBs
NCBI-ProteinID: AAZ60143
UniProt: Q474P0
LinkDB All DBs
Position
1:826495..827148
Genome map
AA seq 217 aa AA seqDB search
MGKTTLTISSKTYSSWSLRGWLLARFAGLEFEEVLVTPDDPAVRAEILLLSPSILVPCLR
HQGVTVWDTLAIAEYLNEISPKAGLLPDDRAARAHCRAICGEMHSGFAAMRAALPMNLKG
HFPGLKVWSRAQADIDRITAIWTECLTRYGGPYLFGTRTMADAMYAPVVTRFVTYGVMLD
PVPVEYCKQILSMPELQEWTAAAREEPDEISELDVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaccacactcaccatcagcagcaagacctattcgtcatggtcgctgcgcggc
tggctgctggcacgcttcgccgggctggagttcgaagaggtgctggtgaccccggacgac
ccggccgtgcgcgcggaaatcctcctgctgtcgccgtctatcctcgtgccttgcctgcgc
catcagggcgtgaccgtgtgggacacgctcgcgatagccgagtacctgaacgaaatcagt
cccaaggcggggctgctgcccgacgaccgcgccgcccgcgcgcactgccgcgcgatctgc
ggcgaaatgcactccggctttgcggccatgcgtgcggcgctgccgatgaacctcaagggg
catttccccgggctgaaggtgtggtcgcgggcgcaggccgatatcgaccgcatcacggcg
atctggacggagtgcctgacgcgctatggcgggccctacctgttcggcacgcgcacgatg
gcggacgccatgtatgcgccagtcgtgacccgcttcgtgacctacggcgtcatgctcgac
ccggtgccggtcgaatactgcaagcagatcctgtcgatgcccgaactgcaggagtggacg
gcggcagcgcgcgaagagcccgacgagatcagcgaactcgacgtcgaattctga

DBGET integrated database retrieval system