KEGG   Ralstonia eutropha JMP134: Reut_A1011Help
Entry
Reut_A1011        CDS       T00268                                 

Definition
(GenBank) probable gst-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Reut_A1011
Enzymes [BR:reu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Reut_A1011
Transporters [BR:reu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Reut_A1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AAZ60390
UniProt: Q473P3
LinkDB All DBs
Structure
PDB: 

Position
1:1100154..1100795
Genome map
AA seq 213 aa AA seqDB search
MLKLCGFAASNYYNKVKLALLEKNVPFEEVLAWIGETDTTATPAGKVPYMITESGSLCES
EVINEYLEAAYPQTPLLPRDPMQAGKVREIVTFLELYLELTARELYPEAFFGGKVSDNVK
ERQLKLLSRYVPAFAKLAKFSPYVAGDTFTLADCAAAVHLPLVSSCTKIIYGKDLLADLP
VKEYLKTLSERPSVQKVNADRKANTELMLSRNK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgtgcggatttgccgccagcaactactacaacaaggtcaagctggcactg
ctggaaaagaatgtgccgttcgaggaggtgctggcctggatcggcgagaccgacacgacc
gccacgccagccggcaaggtgccctacatgatcaccgaatcgggttcgttgtgcgagtcg
gaagtcatcaacgaatacctggaagccgcttatccgcagacgccgctgctgccgcgcgat
ccgatgcaggccggcaaggtacgcgaaatcgtcacattcctggagttgtacctcgaactg
accgcgcgcgagctgtacccggaggcgttcttcggcggcaaggtcagcgacaacgtgaag
gagcgccagctcaagctgctgtcgcgctatgttcccgcgttcgcgaagctcgcgaagttc
tcgccgtatgtggcgggcgatacctttacgctggcagactgcgctgcagcggtccacctg
ccgctggtgtcctcgtgcacgaagatcatctacggcaaggacctgctggccgacctgccg
gtcaaggaatacctgaagacgctgtcggagcgcccgtcggtgcagaaggtcaatgccgac
cgcaaggcgaacaccgagctgatgctgagccggaacaagtaa

DBGET integrated database retrieval system