KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1699
Entry
Reut_A1699        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P0 subunit
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1699
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1699
   00623 Toluene degradation
    Reut_A1699
SSDB
Motif
Pfam: Phenol_hyd_sub
Other DBs
NCBI-ProteinID: AAZ61064
UniProt: Q470W9
LinkDB
Position
1:1834957..1835211
AA seq 84 aa
MTTPIVHSASSASRRSQPYVRVTSHGQQWVEFEFSLGDPALYVELVMRPDQFTAFCAAQC
AITVSHQLGRALERERDKWCETVA
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaccacgcccatcgtccattccgcctcgtcagcttcccgccggtcgcagccctacgtc
cgggtgacctcgcacggccagcaatgggtcgagttcgagttctcgctcggagaccccgcg
ctgtatgtggagctggtcatgcgccctgaccagttcaccgcgttctgcgcggcgcagtgc
gccatcacggtgtcgcatcagctcggccgtgcgctggaacgcgaacgcgacaaatggtgc
gagaccgtggcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5680
Entry
Reut_B5680        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P0 subunit
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5680
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5680
   00623 Toluene degradation
    Reut_B5680
SSDB
Motif
Pfam: Phenol_hyd_sub
Other DBs
NCBI-ProteinID: AAZ65025
UniProt: Q46PA9
LinkDB
Position
2:2512944..2513153
AA seq 69 aa
MISPSATTGDALPDVDVTRKFVSRVERHDDGLVSFEFAIGWPELSVDLLLPEPAFMAFCD
RHQVTRLEN
NT seq 210 nt   +upstreamnt  +downstreamnt
atgatttccccctccgccacaaccggcgatgcactgcccgatgtcgatgtcacgcgcaag
ttcgtgagccgcgtcgagcgccatgacgacgggctggtgagcttcgagttcgccatcggc
tggccggagttgagcgtagacctgctgctgccggagccggccttcatggccttctgcgac
cggcatcaggtgacaaggctggaaaactga

DBGET integrated database retrieval system