KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1700
Entry
Reut_A1700        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P1 subunit
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1700
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1700
   00623 Toluene degradation
    Reut_A1700
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1700
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1700
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AAZ61065
UniProt: Q470W8
LinkDB
Position
1:1835259..1836281
AA seq 340 aa
MQIDIRTDSVSPIRQTFANLARRLGADKPATRYQEAMYDLQPETSFHYRPLWQPQYELYD
ARRTQVVMQDWYALKDPRQFYYGSYVNARARQQEMMEKNLEFVEKRGLLASLPEPLREVL
TSGVVPLRHVEWAANMNNAAITAYGFGSAITEAAMFQTMDRLGIAQYLTRIGLLVGDKAA
VDAAKAAWLEDLAWQPLRHAIEDLLVRDDWFELHVAQNLVMDGLLYPLIYQRLDARLSAE
SPAFSLVTDFMNAWYAETARWVDATVKTAAQESPENASVIAGYAFTWLDRFQHALAPLAR
RLFAGDAGAALDESVAALTKRLAGLGLTRATDETPAKAAA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcaaatcgatatccgcacggacagcgtcagcccgatccgccagaccttcgccaacctg
gcgcgccgcctcggcgcagacaagccggccacgcgctaccaggaggcaatgtacgacctg
cagccggaaaccagcttccactaccgcccgctgtggcagccacagtacgagctgtacgac
gcgcgccgcacgcaggtggtcatgcaggactggtacgcgctgaaggacccgcgccagttc
tactacggcagctacgtcaacgcccgcgcacgccagcaggaaatgatggaaaagaacctg
gagttcgtggagaagcgcggcctgctggcatcgctgcccgagccgctgcgcgaggtgctg
acgagcggcgtggtgccgctgcgccatgtcgaatgggcggccaacatgaacaacgccgcc
atcaccgcgtatggctttggctccgccatcaccgaagcggcgatgttccagacgatggat
cgcctcggcatcgcgcagtacctgacccgcatcggcctgctggtgggcgacaaggccgcc
gtcgacgcggccaaggcggcatggctggaagacctggcctggcagcctctgcgccatgcg
atcgaggacctgctggtgcgcgatgactggttcgaactgcacgttgcgcagaacctggtg
atggacgggctgctgtacccactgatctaccagcgcctcgatgcacgcctgtccgccgaa
agcccggcgttctcgctggtcaccgacttcatgaacgcctggtacgccgagacggcgcgc
tgggtcgatgccacggtcaaaaccgctgcgcaggagtcgcccgagaacgccagcgtgatc
gccggctatgccttcacctggctcgaccgcttccagcatgcgctggcaccgctcgcgcgc
cgcctgttcgctggcgatgctggagctgcgctggacgagtctgtggccgctctgaccaag
cggcttgcgggactgggtctgacccgtgccactgacgaaacaccggctaaggccgctgcc
tga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5681
Entry
Reut_B5681        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P1 subunit
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5681
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5681
   00623 Toluene degradation
    Reut_B5681
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5681
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5681
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AAZ65026
UniProt: Q46PA8
LinkDB
Position
2:2513207..2514214
AA seq 335 aa
MNIDLQTREITPLRQTFAHVARLVGEGKAATRYQEATYGGQPMANFHYRPTWDPAHELFD
ASRSRIRLADWQALKDPRQFYYATWTMTRARQQEAVEANFQFVESRGLAGSMSDALRTRL
LDVLLPLRHVAWGANMNNAAICAYGYGTAFTAPAMFHAMDHLGIAQLITRLALALDEPDV
LDAGKRAWLDDPCWQDLRRYVEDTFVVQDPVELFVAQNLALDGLLYPLVYGHYVDDHVTL
HGGTAAAMLTSFMPEWHDETTRWIDAVVKAMVATAEPEAAANRELLTQWFRHWAGRAAQA
LAPVAELALGENGAAALGEVCAALDARAAKLGLAP
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaatatcgatctgcagacccgcgagatcacgccgttgcggcagacgttcgcacacgtt
gcacgacttgtcggcgaaggcaaggccgcaacccgctatcaggaggccacctatggcggg
cagcccatggccaacttccactaccggccgacgtgggacccggcgcatgaactgttcgac
gccagccgcagccgtatccgtctggccgactggcaggccctgaaggacccgcgccagttc
tactacgccacgtggacgatgacccgcgcgcggcagcaggaggcggtggaggccaacttc
cagttcgtggagtcgcgcggcctggccggttcgatgagcgatgcgctgcgcacgcggctg
ctcgacgtactgctgccgctacgccacgtggcctggggcgcgaacatgaacaacgcagcg
atctgcgcctatggctacgggacagcgttcactgcgccggcgatgttccatgcgatggac
cacctcggcatcgcgcaattgattacccgcctggcgctggcgctggacgagcccgacgtg
ctggatgctggcaagcgcgcctggctcgacgatccgtgctggcaggacctgcgccgctac
gtggaggacaccttcgtcgtgcaggacccggtggagctgttcgtcgcgcagaaccttgcg
ctcgatggcctgctgtacccgctggtctacggccattacgtcgatgaccacgtcacgctg
catggcggcacggcggcggccatgctaaccagcttcatgcccgagtggcacgacgagacc
acgcgctggatcgacgccgtcgtgaaggcgatggtcgcgacagccgagcccgaggcggct
gcgaaccgcgaactactgacgcagtggttccggcactgggccggccgcgccgcgcaggcc
ctggcgcccgtcgccgaactggcgctcggtgagaacggtgccgccgcgctcggcgaagtc
tgcgcggcgctcgatgcacgcgccgcgaagctcggcctcgcgccctga

DBGET integrated database retrieval system