KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1701
Entry
Reut_A1701        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P2 subunit
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1701
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1701
   00623 Toluene degradation
    Reut_A1701
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1701
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1701
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AAZ61066
UniProt: Q470W7
LinkDB
Position
1:1836298..1836570
AA seq 90 aa
MTAQIVFIALQANEEMRPVIDAIEADNPHATVNRYPAMVKIDAPGRLEINRASVEERMGR
AWDVQELQLGLISLAGNIDETEDQFVLAWH
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaccgcacagatcgtattcatcgcgctgcaggccaacgaggagatgcgtcccgtcatc
gacgccatcgaggccgacaacccgcacgccaccgtcaaccgctacccggccatggtcaag
atcgacgcgcccggacggctcgagatcaaccgcgccagcgtggaagagcgcatgggacgc
gcgtgggacgtgcaggaactgcagctcggcctgatctcgctggccggcaacatcgacgag
accgaagaccagttcgtgctggcctggcactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5682
Entry
Reut_B5682        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P2 subunit
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5682
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5682
   00623 Toluene degradation
    Reut_B5682
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5682
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5682
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AAZ65027
UniProt: Q46PA7
LinkDB
Position
2:2514253..2514522
AA seq 89 aa
MSQVFIAFQANEESRPVVEAIVTDNPEAVVSYPTGLVKIDAPGRLTIRRETIEEQTGRPF
DLQQLHVNLVTLSGHIDEDDDQLTLSWNH
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtcccaggtctttatcgccttccaggccaatgaggaatcgcgtccggtcgtcgaagcg
atcgtgactgacaaccccgaggcggtcgtcagctatcccacggggctcgtcaagatcgat
gcccccggccggctcaccatccgtcgcgaaaccatcgaggaacagaccggccggcccttc
gacctgcagcagcttcacgtaaatctggtcacgctgtcgggccacatcgacgaagacgac
gaccagctcacgttgagctggaaccactga

DBGET integrated database retrieval system