KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1703
Entry
Reut_A1703        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P4 subunit
  KO
K16245  phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1703
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1703
   00623 Toluene degradation
    Reut_A1703
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1703
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1703
SSDB
Motif
Pfam: Phenol_monoox
Other DBs
NCBI-ProteinID: AAZ61068
UniProt: Q470W5
LinkDB
Position
1:1838220..1838582
AA seq 120 aa
MPVIALNPGYAGETRDRVENFHGNQLVYFGWDQHLLFCSPFTLPLPPDMPFGTMVSDVIA
PLLAAHPEGAAIDWTQVQWLLGGEPFAPDADASLAVNGLGHKSLLRLRTPELRGIAGSCN
NT seq 363 nt   +upstreamnt  +downstreamnt
atgccagtcatcgcactgaacccgggctacgcgggcgaaacccgcgaccgcgtcgagaac
ttccacggcaaccagctcgtgtatttcggctgggaccagcacctgctgttctgcagcccg
ttcacgctgccgctgccgcccgacatgccgttcggcaccatggtcagcgacgtcatcgcg
ccactgctcgccgcgcatcccgaaggcgcggctatcgactggacgcaggtgcagtggctg
ctcggcggcgagccctttgcgccggatgcggacgccagcctggccgtcaacgggctcggc
cacaagtcgctactgcgcctgcgcacgccggaactccgcggcattgccggctcgtgcaac
tga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5684
Entry
Reut_B5684        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P4 subunit
  KO
K16245  phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5684
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5684
   00623 Toluene degradation
    Reut_B5684
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5684
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5684
SSDB
Motif
Pfam: Phenol_monoox
Other DBs
NCBI-ProteinID: AAZ65029
UniProt: Q46PA5
LinkDB
Position
2:2516113..2516481
AA seq 122 aa
MSVVANPAAGVPYQFPMKDVRENFPAPLLYIGWEDHLMFCSPVCVPLPPEMPFGALVSQV
LPGIYAEHPDFERIDWSTVQWFRSGKPWTPDPVASLAANGLGHKDVIRFRTPGLAGINGS
CS
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagcgtcgtcgccaatcccgctgccggggtgccttaccagttccccatgaaggacgtt
cgtgagaacttccccgcgccgctgctgtacatcggatgggaagaccacctgatgttctgc
tcgccggtctgtgtgccactgccgcccgagatgccattcggcgcgctcgtcagccaggtg
ctgcccggcatctacgccgagcaccccgacttcgagcgtatcgactggagcacggtgcag
tggttcaggtcgggcaagccgtggacgcccgacccggtggcctcgctcgccgcgaacggg
ctgggccacaaggacgtcatccgttttcgcacgccgggccttgccggcatcaacggttcc
tgcagctaa

DBGET integrated database retrieval system