KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1704
Entry
Reut_A1704        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P5 subunit
  KO
K16246  phenol/toluene 2-monooxygenase (NADH) P5/A5 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1704
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1704
   00623 Toluene degradation
    Reut_A1704
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1704
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1704
SSDB
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 Fer2_4
Other DBs
NCBI-ProteinID: AAZ61069
UniProt: Q470W4
LinkDB
Position
1:1838599..1839657
AA seq 352 aa
MTYQLTIEPLGQTIGIEEGQTVLDACLRAGVWLPHACGHGLCGTCKVQTLEGELDHGEAS
PFALMDFEREEAKCLACCAKPMSDMVIEVDIEPDPDAQCLPLMDFTAEVVRIEALTPTIK
GVFLRIEGEPLQFQPGQYVNVWIGKEAAPRAFSIASAPTAGEIELNIRLVPGGSATTYVH
EQLSVGERLQLSGPLGRFFVRKSDPRPLVFMAGGSGLSSPRSMILDLLESGDQREIVLVQ
GARNAGELYYRDAFEALARQHDNFTYLPVLSGEPEQSDWGGERGYVHDLASRHFSQDFRG
WRAYLCGPPPMIEACIATLMQGRLFEKDIFTEKFLSAADASQATRSPLFRSL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacctaccaactgaccatcgagcccctcgggcagaccataggcatcgaggaaggccaa
accgtgctcgacgcgtgcctgcgcgccggcgtgtggttgccgcatgcgtgcggccacggt
ctatgcgggacctgcaaggtgcagacgctcgaaggcgaactcgatcacggcgaagcatcg
ccattcgcgctgatggatttcgagcgcgaagaagccaagtgcctggcctgctgcgcgaag
ccgatgtccgacatggtgatcgaggtcgatatcgagcccgatcccgatgcgcagtgcctg
ccgctgatggatttcaccgcggaagtcgtgcgcatcgaggcgctgacgcccaccatcaag
ggcgtgttcctgcgcatcgaaggcgagccgctgcagttccagccgggccagtacgtcaac
gtgtggatcggcaaggaagccgcgccacgcgccttctccatcgccagtgcgccgaccgcg
ggcgagatcgaactgaacatccggctcgtgcccggcggcagtgcgacgacctatgtgcac
gaacaacttagcgtgggtgagcgcctgcagctgtcgggcccgctgggccggttcttcgtg
cgcaagagcgatccgcggccgctggtgttcatggcgggcggctcgggactgtcaagcccg
cgttcgatgatcctggacctgctggaatcgggtgaccaacgcgaaatcgtgctggtgcag
ggcgcacgcaatgccggcgaactgtactaccgcgatgccttcgaagcgctcgcacggcag
catgacaacttcacctacctgccggtgctgtcgggcgagcccgagcaaagcgactggggc
ggcgagcgcggctatgtacacgatcttgcaagccgtcatttcagccaagacttccgcggc
tggcgtgcctacctgtgcgggccgccgccgatgatcgaggcttgcatcgccacgttgatg
caaggccgcctgttcgagaaagacatcttcaccgagaagttcctgtcggcagccgacgcg
agccaggccacccgcagcccgctgttccgctcgctctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5685
Entry
Reut_B5685        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P5 subunit
  KO
K16246  phenol/toluene 2-monooxygenase (NADH) P5/A5 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5685
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5685
   00623 Toluene degradation
    Reut_B5685
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5685
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5685
SSDB
Motif
Pfam: Fer2 FAD_binding_6 NAD_binding_1 Fer2_4 DHODB_Fe-S_bind
Other DBs
NCBI-ProteinID: AAZ65030
UniProt: Q46PA4
LinkDB
Position
2:2516486..2517550
AA seq 354 aa
MCNQITIEPLGATLDVAEGQTLLDAALRSGVYIPHACGHGLCGTCKVQVTSGEVDHGAAN
PFALMDFEREEGKTLACCATALTNVCIEADIDEEPDARVIPVRDFAATVTRIETLTPTIK
GLRLKLDESIDFQAGQYVMVEIPGLGQQRAFSIANAPAEVAETGEIALQVRRVPGGAGTG
VLHEQVQVGDALRVTGPYGRFFVRQSAGMPMLFVAGGSGLSSPRSMILDLLAGGCPLPIT
LINGQRSLEELYGHDEFVDLAARHPNFQYVPVLSGEPEDSDWRGARGYAHDAARTLFDGQ
FAGHKAYLCGPPPMVEATIGTLMQGRLFEEDIYTEKFLSAADADAQRSPLFRRV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtgcaatcaaatcaccattgaacctcttggcgccacgctggacgtggccgagggccag
acgctgctcgacgcagcgctgcgttctggcgtgtacataccgcacgcctgcgggcacggg
ctgtgcggcacgtgcaaggtacaggtgaccagcggagaagtggaccacggcgcggccaac
ccgttcgcgctgatggacttcgaacgggaggagggcaagacgctcgcctgctgcgcgacg
gcgctcaccaatgtctgcatcgaagccgacatcgatgaggagccggacgcccgcgtcatc
ccggtgcgcgatttcgcggcgacggtgacgcgcatcgaaacgctcacgcccacgatcaag
gggctgcgcctgaagctggacgagtcgatcgacttccaggccggccaatacgtgatggtc
gagattcccgggctggggcagcagcgtgcgttctcgattgccaacgctcccgccgaagtc
gcggaaaccggcgagatcgcgttgcaggtgcgccgcgtgcccggcggggcgggaaccggc
gtgctgcatgagcaggtgcaggtcggggacgcgctgcgcgtgactggaccctatggccgc
ttcttcgtgcggcagtcggcgggcatgccgatgctgttcgtcgcgggtggatcgggtctt
tccagccctcgctcgatgatcttggacctgcttgcgggcggctgcccgcttcccatcacg
ttgatcaacggtcagcgcagcctggaagagctgtacggccacgacgagttcgtcgacctg
gctgcgcggcaccccaacttccaatacgtgcccgtgctgtccggcgagccggaagacagc
gactggcgcggtgcgaggggctatgcgcacgacgccgcgcggacgctgttcgacgggcag
ttcgccgggcacaaggcgtacctgtgcgggcccccgccgatggtggaagccacgatcggc
acgctgatgcaggggcggcttttcgaggaggacatctacaccgagaaattcctctcggcg
gcagatgccgacgcgcagcgcagcccgctgttccggcgcgtgtga

DBGET integrated database retrieval system