KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1826Help
Entry
Reut_A1826        CDS       T00268                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
reu  Cupriavidus pinatubonensis JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAZ61191
UniProt: Q470J2
LinkDB All DBs
Position
1:2000635..2002095
Genome map
AA seq 486 aa AA seqDB search
MTNRTIELKHPRQLYIDGVWVEPSTGGVFDVLDCSTEQVVATVARAESADMQRAVAAARK
AFDDGPWPRMTPLERAGFLEKIAVRLEALNDEFARIWSLETGIVYKVAQPRIGLFISGAF
RQYAAMASTFPFTQPCQSVTGNDAYRVYEPVGVVAEIIPWNGPAGLLAYKTAPALLAGCT
LVIKSPPEAPCSGYLFAQVCEEVGLPPGVVNVITAERDVSEALVRSPEVDKITFTGSTAA
GRRIASIAGDRVARVTLELGGKSPAVILDDYDVETAAATLGNSYFSYNTGQICHSLTRII
VPRAKHDAMVEALSAIAREIVLGDPLAATTTSGPLANARQRDTVERFVAMGVAEGAVLAT
GGKRPPHLARGFFFEPTVFGNVDNRSSIAQQEIFGPVLSVIPADDEASAIRMANDTPFGL
NAAVFTNDRDRALAVARQIRAGTVGHNGPRTDFSIGFGGFKQSGIGREGGVEGLTAFMES
KTIVLS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgaactatcgaactcaagcacccgcgccagctgtacatcgacggcgtatgg
gtcgaaccctccaccggcggcgtcttcgacgtgctggactgctccaccgagcaggtcgtg
gcgacagtcgcccgcgccgagtcggccgacatgcagcgcgccgtcgccgccgcccgcaag
gcattcgacgacggcccctggccgcgcatgacgccgctggagcgcgccggcttccttgag
aagatcgccgtgcggctggaagcgctgaacgatgaattcgcccgcatctggtcgctcgaa
accggcatcgtctacaaggtcgcgcagccacggatcgggctgttcatcagcggcgccttc
cgacagtacgcggcaatggcatcgacctttcccttcacacagccgtgccagtctgtcacc
ggcaacgacgcgtatcgggtctacgagccggtgggcgtggtcgccgagatcattccctgg
aacgggcccgccggcctgctcgcgtacaagacagcgccggcgctgctggcgggctgcacg
ctggtcatcaagtcgccgcccgaggcgccgtgctcgggctacctgttcgcgcaggtttgc
gaggaagtcggcttgcccccgggcgtggtcaacgtcatcaccgccgaacgcgacgtgtcc
gaggcactggtgcgcagcccggaggtcgacaagatcacattcaccggctcgactgcggcc
ggccgccgtatcgcatccatcgccggcgaccgcgtggcgcgcgtgacgctggaactcggc
ggcaagtcgcccgccgtcatcctcgacgactacgacgtcgaaaccgccgcagcgacgctg
ggcaattcctacttcagctacaacaccgggcagatctgccatagcctcacccgcatcatc
gtgccacgcgcaaagcacgacgcgatggtcgaggcactgtccgccatcgcgcgggagatc
gtgctaggcgacccgctcgcggcaacgaccacctcgggccccctcgccaatgcccgccag
cgcgataccgtcgagcgcttcgtcgccatgggcgtggccgaaggcgccgtgctggcgacc
ggcggcaagcggccgccgcacctcgcgcgcggcttcttcttcgagccgacggtattcggc
aacgtcgacaaccgctcgagcatcgcccagcaggaaatcttcggtcccgtgctgagcgtg
atccctgccgacgacgaggccagtgccatccgcatggcgaacgacacgccgttcggcctg
aacgccgccgtcttcaccaacgaccgcgaccgcgcgctcgccgtagcgcggcaaatccgc
gcgggcaccgtaggccacaacggcccgcgcaccgatttctccatcggattcggcggcttc
aagcagtccggcatcggccgcgagggcggcgtcgaaggactgaccgccttcatggagtca
aagaccatcgtgctgagctga

DBGET integrated database retrieval system