KEGG   Ralstonia eutropha JMP134: Reut_A1934Help
Entry
Reut_A1934        CDS       T00268                                 

Definition
(GenBank) Alanine racemase region
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00473  D-Alanine metabolism
reu01100  Metabolic pathways
reu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Reut_A1934
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Reut_A1934
Enzymes [BR:reu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Reut_A1934
Peptidoglycan biosynthesis and degradation proteins [BR:reu01011]
 Precursor biosynthesis
  Racemase
   Reut_A1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAZ61299
UniProt: Q46ZY4
LinkDB All DBs
Position
1:complement(2122207..2123328)
Genome map
AA seq 373 aa AA seqDB search
MPRPIHAVIHQPAIANNLEVVRRHAPGSRVWAVIKANAYGHGIRRVFAGLRGTDGFGLLD
LNEAVQLRDLGWQGPILLLEGFFQPQDVPLLEQYRLTTAVHCDEQLRMLESARPKGPLAI
QLKLNTGMNRLGFHPSQYRTAWERARAMPCVGSIVHMTHFSDADTPRGIAHQIEAFDKAT
ANLPGEASLSNSAAVLWHPEAHRAWVRPGVILYGASPTGREADIAGVGLQPAMSLHSELI
AVQDLQPGDTVGYGSMFTADRPMRIGVVACGYADGYPRHATGWGEHRAPVLVDGVRTQLV
GRVSMDMLCVDLGPCPKARIGSPVTLWGQGLPIDDVAQASGTVGYELMCALAPRVPTTVA
TITAPDSASPLLA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaccgatccacgccgtcatccatcaacccgccattgcgaacaaccttgaggtc
gtccgccgtcacgcccccggttcccgcgtatgggccgtcatcaaggccaatgcctatggc
catgggatccgccgtgtgttcgccggcctgcgtggaacggacggcttcgggctgctcgac
ctgaacgaagccgtgcagctgcgcgacctcggctggcaaggcccgatcctgttgctggag
gggtttttccaaccgcaggacgtgccgctccttgaacaataccggctcaccaccgcggtg
cattgcgacgagcagctccggatgctggagagcgcacgcccgaagggtccgctggcgatc
cagctcaaactcaatacggggatgaaccgcctgggcttccacccgtcgcaataccgcacg
gcgtgggagcgcgcacgcgccatgccctgcgtgggcagtatcgtccacatgacgcacttt
tccgatgccgacaccccgcgtggcatcgcccaccagatcgaggccttcgacaaagccacg
gccaacctgccaggtgaggccagcctgtcgaactccgcggcggtcctgtggcatcccgaa
gcgcaccgcgcatgggtgaggcccggtgtcatcctgtatggcgcatcgccgaccggccgc
gaggccgacattgcgggcgtcggcctgcagccggccatgtcgctgcacagcgagctgatt
gcggtccaggacctgcagcctggcgatacggtcggctacggttccatgttcaccgccgac
cggccgatgcgcatcggcgtggtggcctgtggctatgcagatggctacccgcggcatgca
acgggttggggcgaacaccgcgcccccgtgctggtggacggcgtgcgcacccaactcgtg
ggccgcgtgtcgatggacatgctgtgcgtagacctggggccatgcccgaaggcgaggatc
ggcagtcctgtcacgttgtggggccagggcctgccgatcgacgatgtcgcgcaggccagc
ggcacggtgggttacgaactgatgtgcgcgctggcgccgcgcgtgccgaccacggtggca
accattacggcgccggacagcgcctcgccgctgctggcctga

DBGET integrated database retrieval system