KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2214Help
Entry
Reut_A2214        CDS       T00268                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00564  Glycerophospholipid metabolism
reu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Reut_A2214
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Reut_A2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AAZ61577
UniProt: Q46Z56
LinkDB All DBs
Position
1:2447651..2449255
Genome map
AA seq 534 aa AA seqDB search
MPKAPTPIQPPSRAALLARLEREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQLFDQP
FYGIGLKLYDMLAGGLNLDGSRWLNHREVLAAAPTLAEHVGGRPLRGGNLYFDGQFDDAR
LAIALMRTLFDVGGTAINYLPVIGLSQQGGVVNGVTVRDALGDTTFRLRADCVVNATGVW
VDAIRRMEDGQARTMVAPSQGVHLTLPRSFLPGDRAILIPKTDDGRVLFVVPWNGHVIVG
TTDTPRKDLPLEPGASGDDVDFILDTASRYLARDPGRTDVTSVWAGLRPLVKATGEASTA
SLSREHTIVVSRAGLITVTGGKWTTYRKMAEDVIETAIQRQMLRAAPCVTADLPLHGASG
LPADLPAPNSVSPDRYYGNELPALRALPGIDHVLAPASGLTEAHVRFAARHELARRVEDV
LARRNRALFLDARAAVEAAPQVAAILAEELGHDEAWQASEVENFRKLAAGYMLD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccccgaccccgatccagccgccgtcccgagccgccctgctcgcaaggctg
gaacgcgagccgcgctgggacgtgatcgtcatcggtggcggcgccaccggcctcggcacg
gccgtcgatgccgcgtcgcgcggatatcgcacactgctggtggaggccgccgacttcgcc
aagggcacgtcgagcaaggccaccaagctcgtgcacggcggcgtgcgctacctggcccag
ggcaatatcagcctggtgcgcgaagcgctgcatgaacgcgggctgctcgcccgcaacgcg
cctcacctcgtgtggccgctcggctttgtcgtaccggcttaccagctgttcgaccagccg
ttctatggcatcggcctgaagctttatgacatgctggccggcggcctgaatctcgatggc
agccgctggctcaaccaccgcgaggtactggccgccgcccccacgctggccgagcatgtc
ggcggacgcccgctgcgcggcggcaacctgtacttcgacggccagttcgacgacgcacgc
ctcgccattgcgctgatgcgcacgctgttcgacgtcggcggcaccgccatcaactacctg
ccggtaatcggcctgtcgcagcagggcggcgtggtcaatggcgtgaccgtgcgagatgcg
cttggcgataccacgttccgcctgcgcgcggattgcgtggtcaatgccaccggcgtgtgg
gtggatgccatccgccggatggaagacgggcaggcgcgcaccatggtcgcgccgagccag
ggtgtgcatctgacgctgccgcgcagcttcctgcccggcgatcgcgccatcctgattccg
aagaccgatgacggccgcgtgttgttcgtggtgccgtggaacgggcatgtcatcgtcggc
accaccgacacgccgcgcaaggacctgccgctggagcctggcgcaagcggcgacgatgtg
gatttcatcctcgataccgcttcgcgttacctggcgcgcgaccccggccgcaccgatgtc
acaagcgtctgggccggattgcggccgctggtcaaggcgacaggcgaggcatccacggct
tcgctgtcgcgcgagcacaccatcgtggtgtcgcgcgccgggctgatcacggtgaccggc
ggcaaatggaccacgtaccgcaagatggccgaagatgtcatcgagacggccatccagcgc
cagatgctgcgcgccgcgccttgcgtgaccgccgatctgccgctgcacggcgcgagcggc
ctgccagccgacctgcccgcgccgaattcggtgtcgcccgatcgctactatggcaatgag
ttgcccgcattgcgcgccttgcccggcatcgaccatgtcctggcgccggcgtccgggctg
accgaggcgcacgtgcgctttgcggctcgccatgaactcgcgcgccgcgtcgaggatgtg
ctggcgcggcgcaaccgcgcgctgttcctggacgcgcgcgcggccgtggaagccgcccca
caggtggcagcgatcctggcggaagaactgggccacgacgaagcctggcaggccagcgaa
gtggaaaacttccgcaagctcgccgccggatacatgctcgactga

DBGET integrated database retrieval system