KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2588Help
Entry
Reut_A2588        CDS       T00268                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein, PAAT family
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:reu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Reut_A2588
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:reu02000]
    Reut_A2588
   02035 Bacterial motility proteins [BR:reu02035]
    Reut_A2588
Transporters [BR:reu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    Reut_A2588
Bacterial motility proteins [BR:reu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    Reut_A2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd T3SS_HrpK1
Motif
Other DBs
NCBI-ProteinID: AAZ61949
UniProt: Q46Y34
LinkDB All DBs
Position
1:complement(2838553..2839365)
Genome map
AA seq 270 aa AA seqDB search
MRSIRHGWLKSLLAASLIAGAAGLSATAASAADLLDTVKQAGVLKIGLEGTYPPFGFRNP
KNELDGFDVDVARAVAAKLGVKPEFVTTEWSGIIAGLQAGKFDVIVNQVSVTPQRKQVLD
FSTPYVYSAAQLIQRKDDKREFNSLEALKGHKLGVSLGSNYNELAKSVPGIDVKTYPGAP
EYLRDLAAQRVDAALNDRLMVNYLIKTANLPLRPGAVVAGANAEVAIPFRKDNPKFAQAI
DHALDDLRKDGTLTKLSVKWFGSDVTKPGK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgattcgtcatggctggctcaaatccctgctggctgcctcgctgatcgccggc
gccgccggcctgagcgccaccgcggccagcgccgcggacctgctcgatacggtcaagcag
gccggtgtcctgaagattggcctggagggcacctatccgccgttcggcttccgcaacccg
aagaacgagctcgatggattcgacgtggatgtggcacgtgccgtcgccgcgaagctcggc
gtgaaaccggagttcgtgaccacggaatggagcggcatcattgccggcctgcaggcgggc
aagttcgacgtgatcgtcaaccaggtttcggtgacgccgcagcgcaagcaggtgctggac
ttctcgacgccttatgtctactcggccgcgcagcttatccagcgcaaggatgacaagcgc
gagttcaattcgctggaagcgctcaagggccacaagctcggcgtgagcctgggtagcaac
tacaacgaactggccaagtcggtgccaggcatcgacgtcaagacctatcccggtgcgcca
gagtacctgcgcgacctggccgcgcagcgggtcgacgccgcactcaacgaccggctcatg
gtcaactacctgatcaagaccgccaacctgccgctgcgcccgggcgcggtggtggcgggc
gcgaatgccgaagtggccatcccgttccgcaaggacaacccgaagttcgcccaggccatc
gaccatgcgctcgatgacctgcgcaaggacggcacgctgaccaagctgtcggtgaagtgg
ttcgggtcggacgtgaccaagcccggcaagtaa

DBGET integrated database retrieval system