KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3678Help
Entry
Reut_B3678        CDS       T00268                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD+)
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00620  Pyruvate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_B3678
   00620 Pyruvate metabolism
    Reut_B3678
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Reut_B3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA TolB_like
Motif
Other DBs
NCBI-ProteinID: AAZ63036
UniProt: Q46UZ8
LinkDB All DBs
Position
2:complement(259029..260549)
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVTNPYKQQYENYIGGAWVPPAGGEYFEAITPITGKPFTRVPRSKQEDVDA
ALDAAHAAKAAWGRTSTTERANILNRIADRIEANLTLLAVAETIDNGKPVRETMAADLPL
AVDHFRYFAGCIRAQEGGISEIDAETIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILALMEVIGDLLPPGVVNVINGFGLEAGKPLASSPRISKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAYFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDKGTMIGAQASAEQLEKILSYIDLGR
KEGAQCLAGGERNQFDGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggccgaaatcgcccagctgggcgtcaccaacccctacaagcagcagtacgaa
aactatatcggcggggcctgggtgccgcccgctggcggcgaatacttcgaggccatcacg
ccgatcaccggcaagccgttcacgcgcgtaccgcgctcgaagcaggaagatgtcgatgcc
gcgctcgatgctgcgcatgcagccaaggcggcctggggccggacctcgactaccgagcgc
gccaacatcctgaaccgcatcgccgatcggatcgaagccaacctgaccctgctggccgtg
gccgagactatcgacaacggcaagcccgtgcgcgagaccatggccgcggacctgccgctg
gcggtggaccacttccgctactttgccggctgcatccgcgcgcaggaaggcggcatctcg
gaaatcgacgcggagaccatcgcctaccacttccacgagccgctgggcgtggtgggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctcgcgccggcgctggcc
gcgggcaactgcgtggtgctcaagccggccgagcagacgcccgcgtcgatcctcgcgcta
atggaggtgatcggcgacctgctgccgccgggcgtggtcaatgtcatcaacggcttcggc
ctggaagcgggcaagccgctggcatcgagcccgcgcatcagcaaggtggcgttcacgggc
gagaccacgacgggccgcctgatcatgcaatacgcgtcgcagaacctgatcccggtcacg
ctggaactcggcggcaagtcgccgaacatcttcttcgaggacgtgctggccgctgacgat
gcgtacttcgacaaggcactggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgaccgattcatggaacgc
gcgctcaagcgtgtggcagcgatccgccagggacatccgctcgacaagggcaccatgatc
ggcgcgcaggcatcggccgagcagctcgagaagatcctgtcctacatcgacctgggccgc
aaggaaggcgcgcaatgcctggcaggcggcgaacgcaaccagttcgatggcgatctcgcg
ggcggctactacgtaaagccgaccgtgttcaagggccacaacaagatgcgcatctttcag
gaggaaatcttcgggcccgtggtgtcggttaccacgttcaaggatgaggaagaagcgctg
gctatcgccaatgacacgctctacggcctcggcgccggtgtctggacgcgcgacggcgcg
cgcgcgttccgcatgggccgcggcatccaggcgggccgtgtgtggaccaactgctaccac
gcgtatcccgcgcatgccgcattcgggggatacaagcagtccggcatcggccgcgagaac
caccgcatgatgctcgaccactaccagcagaccaagaacctcctggtcagctacagcccc
aacgctctcggctttttctga

DBGET integrated database retrieval system