KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4201Help
Entry
Reut_B4201        CDS       T00268                                 

Definition
(GenBank) Isocitrate dehydrogenase NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00480  Glutathione metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_B4201
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Reut_B4201
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Reut_B4201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AAZ63554
UniProt: Q46TI0
LinkDB All DBs
Position
2:841140..843383
Genome map
AA seq 747 aa AA seqDB search
MSTQQPTIIYTLTDEAPLLATSAFLPIIRTFTKPADVNVVTSDISVAGRILGEFPEFLTE
EQRVPDNLAELGKLTQDPDTNIIKLPNISASLFQLTSAIKELQSKGFKVPDYPEDPKTDE
EKAIQKRYSKVLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSITLDKAREVRMELATKSGKTIVLKPKVSLQDGEIIDSMFMSKKALLAFYED
QMEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKVFYKDAFAKHQKLFDELGVNVNNGLV
DLYTKIEQLPESKKEEVIRDMHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRTKDTKCLIPESTFARIYQEIINFCKTNGAFDPVTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGEARIVDNATGEVLSALTQKVEQGDIWRMCQVKDAPIRDWVKLAVT
RARNSGMPAVFWLDAYRPHEAELIKKVETYLKDYDTKGLDIQIMSQVRAMRYTLERVIRG
LDTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVE
ENHLRWDSLGEFLALAVSLEELGIKSGNAKAKVLAKTLDAATGKLLDNAKSPSPKTGQLD
NRGSQFYLAMYWAQELAAQTEDAALAATFAPLAKQLTDNEKTIVGELSDVQGKPVDIGGY
YMPDAEKLSAIMRPSKTLNAALDSVQG
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaacccaccatcatctacaccctgactgacgaagcccccctgctggcg
accagtgctttcctacctatcatccgcactttcaccaagccggccgatgtcaacgtcgtc
accagcgatatctcggtagccggccgtatcctcggcgaattccccgagttcctgaccgaa
gaacagcgcgtgccggacaacctggccgaactgggcaagctgacgcaggaccctgacacc
aacatcatcaagctaccgaacatcagcgcgtcgctattccagctgaccagcgccatcaag
gaactgcaatcgaagggcttcaaggttccggactatccggaagacccgaagaccgatgag
gaaaaggcgatccagaagcgctactcgaaggtgctcggcagcgccgtgaacccggtcctg
cgcgaaggcaactcggaccgccgcgcgccggccgccgtcaagaactacgcccgcaagcac
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtggcccatatgaagcac
ggcgacttctaccatggcgaaaagtcgatcacgctggacaaggcgcgtgaagtgcgcatg
gaactggccaccaagagcggcaagaccatcgtgctgaagccgaaggtttcgctgcaggac
ggcgagatcatcgacagcatgttcatgagcaagaaggccctgctggccttctacgaagac
cagatggaagacgcgcgcaagaccggcgtcatgctgagcctgcacgtgaaggccaccatg
atgaaagtctcgcacccgatcgtgttcggccacgccgtcaaggtgttctacaaggacgcc
ttcgccaagcaccagaagctgttcgacgaactcggcgtgaacgtcaacaacggcctggtc
gacctgtacaccaagatcgagcagctgcccgagtcgaagaaggaagaagtcatccgcgac
atgcacgcttgccacgagcatcgtccggaactggcaatggtcgattcggccaagggcatt
tcgaacctgcacgcgccgaacgacgtgatcgtcgacgcctcgatgccggccatgatccgt
atcggcggcaagatgtggggtgccgacggccgtaccaaggacaccaagtgcctgatcccg
gaatcgaccttcgcccgcatctatcaggaaatcatcaacttctgcaagaccaacggcgcc
tttgatccggtgacgatgggcaccgtgccgaacgttggcctgatggcgcagaaggcagag
gaatacggttcgcacgacaagaccttcgagatcgccgaagacggcgaagcccgcatcgtc
gacaacgcgaccggcgaagtcctgtccgcgctcacgcagaaggttgagcaaggcgacatc
tggcgcatgtgccaggtcaaggatgcgccgatccgcgactgggtcaagctggccgtcacg
cgcgcgcgcaactcgggcatgccggcggtgttctggctggacgcctatcgtccgcacgag
gccgagctgatcaagaaggtggaaacgtacctgaaggactacgacaccaagggcctggat
atccagatcatgtcgcaggtccgcgcaatgcgttacacgctcgagcgcgtgatccgcgga
ctggacaccatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccg
atcatggaactgggcaccagcgccaagatgctgtcgatcgttccgctgatggccggtggc
ggcatgtacgaaaccggcgctggcggttcggcaccgaagcacgtgcagcagctcgtggaa
gaaaaccacctgcgctgggactcgctcggtgaattcctggcgctggctgtgtcgctggaa
gagctgggcatcaagtccggtaacgccaaggccaaggtgctcgccaagacgctggacgcc
gccacaggcaagctgctcgacaacgccaagagcccgtcgccgaagaccggccagctcgac
aaccgcggcagccagttctacctggccatgtactgggcccaggaactcgccgcgcaaacc
gaagatgccgccctggctgccaccttcgcaccgctggccaagcaactgaccgacaacgag
aagactatcgttggcgaactgtccgacgtgcagggcaagccggtcgatatcggcggctac
tacatgccggacgccgagaagctgtccgccatcatgcgtccgagcaagacgctgaacgcg
gcgctggattccgtccagggctga

DBGET integrated database retrieval system