KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4338Help
Entry
Reut_B4338        CDS       T00268                                 

Definition
(GenBank) Copper/Zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Brite
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Reut_B4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AAZ63691
UniProt: Q46T43
LinkDB All DBs
Position
2:998388..998930
Genome map
AA seq 180 aa AA seqDB search
MKRTLFGLAATAAVAMTLAGCAGSGTNGGGGGAKATATLSPKSGTNTGGTVTFTQQAGGV
MMVASVTGLPPNTTHGFHVHEKGDCSAPDAMSAGGHFNPSSKPHGQMSMPDHHAGDMNNL
TADANGNARASILMPDLSVGAGPNSVVGRAVIVHKDPDDYKTQPTGNAGGRIACGVVAAS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacacttttcggcctggcggccacggcagcggtagcgatgaccctggcgggc
tgtgccggctcggggacaaacgggggcggcggcggtgccaaggccaccgcgaccctctcg
ccgaagagcggcactaatacgggcggcacggtcacgttcacgcagcaggccggcggcgta
atgatggtggcatcggtcaccggcctgccgcccaataccacgcacggcttccacgtgcac
gaaaagggtgactgctcggcgcccgacgccatgagcgccggcggtcatttcaacccatcc
agcaagccgcatgggcagatgagcatgcctgaccaccacgccggcgacatgaacaatctc
acggccgacgccaatggcaatgcgcgcgccagtatcctgatgcctgacctcagtgtgggc
gccggaccgaacagcgttgtcggccgcgcggtgatcgtgcataaggatccggacgactac
aagacacagccgaccggcaacgcgggcggccggattgcgtgtggggtcgttgcggcgtcg
tag

DBGET integrated database retrieval system