KEGG   Rhodococcus erythropolis CCM2595: O5Y_01270
Entry
O5Y_01270         CDS       T02806                                 

Definition
(GenBank) GTPase RsgA
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_01270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rey03009]
    O5Y_01270
Enzymes [BR:rey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     O5Y_01270
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     O5Y_01270
Ribosome biogenesis [BR:rey03009]
 Prokaryotic type
  GTPases
   O5Y_01270
SSDB
Motif
Pfam: RsgA_GTPase MMR_HSR1 ABC_tran GTP_EFTU AAA_29 AAA_16 AAA_25 Cytidylate_kin AAA_23 Dynamin_N AAA_33 AAA_28 AAA_22 Guanylate_kin AAA_18 Mg_chelatase DUF87 RNA_helicase Roc IstB_IS21 Septin NACHT AAA_24
Other DBs
NCBI-ProteinID: AGT90140
LinkDB
Position
complement(293385..294455)
AA seq 356 aa
MPENSAPLTEYGWNATLSNTFTALAPPDSAPGRVLRVDRGRCDVAVAEGTVRALSGSDPL
CTGDWVAVAELRDSREPEMHTVTSILPRSSSIVRSSASGKSEGQILAANVDTVVIATASD
GDVDLGRIERLLALAWESGATPVVALTKSDAAHYISDTLAEVTAIAPGATVLAVSAETNE
GMDVLDAVLDGTVAILGPSGAGKSTLANALLADTTDADRLETGRVRTGDGKGRHTTVTRE
LISFSGGRTLIDTPGLRGVGMWNAAEGIEKTFPEIEELIAECRFSDCAHNSEPGCAVLSA
LGRGDIDERRLASYRKLQRENAWNAARSDARLQAERTREIKVISRQLKSHYRGRDR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgccggaaaacagcgcgcccctgaccgaatacggttggaacgcaacactctcgaacaca
ttcactgccctggccccaccggactccgcacccgggcgcgttcttcgcgtcgaccggggg
cggtgtgacgtggccgtcgccgaaggcacagttcgcgcactcagcggcagcgatccactc
tgtacgggtgactgggtcgccgtggccgagttacgggactcacgcgaacccgagatgcac
acggtcacttcgatactccctcgatcaagcagcatcgttcgatcctcggcatccggaaaa
tcggaaggccagattctggcggccaatgtcgacaccgtcgtcatcgccacggcttcggac
ggcgacgtcgatctcgggcgcatcgagcgactactcgcactcgcctgggaaagtggtgca
acccctgtcgtcgcactcaccaaatcggatgcagctcactatatctccgacactctcgcc
gaggtcactgccattgcgcccggcgcaacagtgctggccgtcagtgccgagaccaacgaa
ggaatggatgtactcgatgcagttctggacggcaccgtggcgatactcggtccatcaggc
gccggtaagtcgacgctcgcgaacgccctcctcgcggacaccacagacgccgatcgactc
gagaccggtcgcgttcggaccggtgacggaaagggacgccacaccaccgtcaccagagag
ttgatctcattctccggcggccggacactgatcgacacacccggcctgcgaggggtcggc
atgtggaacgcggcggaggggatcgagaagacgttccccgagatcgaggagctgattgca
gagtgccggttctccgattgcgcacacaactccgagccgggatgcgcagtcctgagcgca
ctcgggcgtggcgatatcgatgagcggaggctcgcgagctaccggaaactacagcgagag
aatgcatggaacgccgcgcgaagcgatgctcgtctgcaggcagagaggacgcgggagatc
aaggtgatctcccgacaactcaagagtcactaccgcggtcgggaccggtag

KEGG   Rhodococcus erythropolis CCM2595: O5Y_10425
Entry
O5Y_10425         CDS       T02806                                 

Definition
(GenBank) GTPase
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_10425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rey03009]
    O5Y_10425
Enzymes [BR:rey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     O5Y_10425
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     O5Y_10425
Ribosome biogenesis [BR:rey03009]
 Prokaryotic type
  GTPases
   O5Y_10425
SSDB
Motif
Pfam: RsgA_GTPase MMR_HSR1 AAA_16 FeoB_N ABC_tran AAA_29 AAA_22 ATP-synt_ab GTP_EFTU AAA_33 Roc AAA_25 HNH_repeat NACHT MobB RNA_helicase AAA_23 Ras
Other DBs
NCBI-ProteinID: AGT91952
LinkDB
Position
complement(2250681..2251565)
AA seq 294 aa
MVVSKDRGRWGCVLGGDPDRLIVTMRARELGRTPIVVGDQVDIVGDLSGKTDTLARIVRV
SERSTVLRRTADDTDPFERIVVANAEQLLIVVALADPPPRTGFVERALVAAYVGGLTPIV
CLTKSDLEPPEEFASTFADLDIQVVVAGRDDPLDELTQILEHKLTALIGHSGVGKSTLVN
RLVPDANRAVGIVSGVGKGRHTSTQSVALPLAGGGWVIDTPGIRSFGLAHISPENVVAAF
SDLAAAIEDCPRGCTHLGPPADPECKLDLLEGKSARRVVAVRQLLEAIKSNDQY
NT seq 885 nt   +upstreamnt  +downstreamnt
atggtggtgtcgaaggatcgtggccgttggggttgcgtcctcggcggcgatcccgaccga
ctgatcgtcacgatgcgtgcccgcgaacttggccgaacccccatcgtcgtcggcgatcag
gtggacatcgtcggcgatctgtccggcaaaaccgacaccctcgcccgcattgtccgggtc
tccgagcgttcaacggttctgcgacggacggccgacgacaccgatcccttcgaacgcatc
gtcgtcgcgaacgcggagcagttgctcatcgtcgtggcactcgccgatcccccaccgcgc
accggttttgtcgagcgcgcactggtcgccgcctacgtgggtggcctgacaccgatcgtc
tgcctgaccaagagcgacctcgaaccacccgaggaattcgcgagcactttcgccgacctc
gacatccaagtggtcgtcgccggtcgcgacgatcccctggacgaactgacgcagatcctc
gagcacaagttgaccgccctgatcggacattccggcgtcggaaaatcgacattggtcaat
cgccttgtccccgatgccaatcgagcggtcggcatcgtatccggcgtcggcaagggccgg
cacacatcgacgcaatcggtggcactccccctcgccggtggcggttgggtgatcgacacc
cctggcatccgttcgttcggtctggcgcacatctcgcccgagaacgtggtggctgcattc
tcggatctcgctgcggcgatcgaggattgcccgcgcggatgcacgcacctcgggccgccg
gcagaccccgaatgcaagctcgacctgctggagggcaaatccgctcgacgcgtcgtcgct
gtgcgacaactgctggaagcgatcaagtccaacgatcagtactga

DBGET integrated database retrieval system