KEGG   Rhodococcus erythropolis CCM2595: O5Y_02780Help
Entry
O5Y_02780         CDS       T02806                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00250  Alanine, aspartate and glutamate metabolism
rey00280  Valine, leucine and isoleucine degradation
rey00410  beta-Alanine metabolism
rey00640  Propanoate metabolism
rey00650  Butanoate metabolism
rey01100  Metabolic pathways
rey01120  Microbial metabolism in diverse environments
Module
rey_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O5Y_02780
   00650 Butanoate metabolism
    O5Y_02780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O5Y_02780
   00280 Valine, leucine and isoleucine degradation
    O5Y_02780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O5Y_02780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rey01007]
    O5Y_02780
Enzymes [BR:rey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O5Y_02780
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     O5Y_02780
Amino acid related enzymes [BR:rey01007]
 Aminotransferase (transaminase)
  Class III
   O5Y_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGT90431
LinkDB All DBs
Position
607142..608506
Genome map
AA seq 454 aa AA seqDB search
MSAIEYRLPQERRIVTEFPGPRSAALAERRKKVVGAGVASTLPVYVADADGGVIVDVDGN
SLIDLGAGIAVTSVGASNPAVVSAVQDQVAHFTHTCFMVAPYEGYVEVAERLAELTPGDH
EKRSVLFNSGAEAVENAVKIARHATGRDAVVVFDHAYHGRTNLTMALTSKSMPYKSGFGP
FAPEVYRVPMSYPYREGLNVDGSKITGEQAAQRAITMIEKQVGAANTAAILIEPIQGEGG
FIVPAEGFLPTLVAWAKENGVVFIADEVQAGFARTGAWFASDHEGIVPDLVTLAKGIAGG
MPLAAVTGRAELIDAVHPGGLGGTYGGNPVACAAALASIDQMRELDLCGRARTIESTVVG
RMNALAKELDVIGDVRGRGAMLAIELVKPGGQEPDADITKKIAAECLAAGVVILTCGTYG
NVIRLLPPLVISEELLDDALTVLETAIRTAAQGN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaatcgaataccggcttccgcaggagcgtcgcatcgtcacggagttcccgggc
ccgcgctcggctgcgctcgccgaacgccgtaagaaggtcgtcggcgccggcgtcgcatcc
accctcccggtctacgtcgccgacgcagacggcggagtcatcgtcgacgtcgacggcaac
tcgctgatcgacctcggtgccggtatcgcggtgaccagcgtcggtgcttccaacccggcc
gtcgtgtccgcagttcaggatcaggtcgcgcacttcacccacacctgtttcatggtcgct
ccgtacgagggctacgtcgaggtcgccgagcgtctcgccgagctcacccccggtgaccac
gagaagcgttccgtgctgttcaactccggcgcagaagccgtcgagaacgccgtcaagatc
gcccgtcacgcaaccggtcgcgacgcagtcgtcgtcttcgaccacgcgtaccacggccgc
accaacctcacgatggcactgacctcgaagtccatgccgtacaagagcggcttcggtccg
ttcgcccccgaggtctaccgcgtaccgatgtcctacccgtaccgcgagggcctcaacgtc
gacggctccaagatcacgggtgagcaggccgcacagcgcgccatcacgatgatcgagaag
caggtcggtgctgccaacacggccgccatcctcatcgagcccattcagggcgagggcgga
ttcatcgttcccgcagaaggattcctcccgacgctcgtcgcgtgggccaaggagaacggc
gtcgtcttcatcgccgacgaggttcaggcaggcttcgctcgtaccggcgcctggttcgcc
agcgatcacgagggcatcgtccccgacctggtcactctcgccaagggcatcgcaggcggc
atgccgctcgccgctgtcacgggccgcgccgagctcatcgacgccgtccaccccggcggc
ctcggtggcacctacggcggtaacccagtcgcctgcgccgctgcattggcgtccatcgac
cagatgcgcgagctcgacctctgtggccgcgcacgcaccatcgagtcgaccgtcgtcggc
cgaatgaacgcactggcaaaggaactcgacgtcatcggtgacgttcgcggtcgcggcgcc
atgctcgccatcgagctggtcaagcccggtgggcaggagccggacgccgatatcaccaag
aagatcgccgccgaatgcctcgctgccggcgtcgtgatcctcacctgcggtacctacggc
aacgtcatccgtctgctcccgccgctggtcatctccgaagagctgctcgacgacgcgttg
accgtcctcgagaccgccatccgcactgcagcacaggggaactga

DBGET integrated database retrieval system