KEGG   Rhodococcus erythropolis CCM2595: O5Y_04380
Entry
O5Y_04380         CDS       T02806                                 

Definition
(GenBank) hypothetical protein
Organism
rey  Rhodococcus erythropolis CCM2595
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 TehB TPMT Ubie_methyltran MTS NodS
Other DBs
NCBI-ProteinID: AGT90751
LinkDB
Position
948967..949551
AA seq 194 aa
MDAHDWDERYRAVTEPWGIDPAGTVATRIADLKPGTAIDLACGDGRHARWMAGQGWSVTA
VDYSSVAIDLARASDLDKAVDWQVGDATTWQPEGVVDLVLVSFLHLEVDELADTLKRVGE
WLTPGGRVLYLGHSIENFHRGVGGPPEPTILPGISDLARAAEGSRVYALEHVVRPQDGKT
AIDVLLEFGPWEQV
NT seq 585 nt   +upstreamnt  +downstreamnt
atggacgcacacgactgggacgagcgataccgagcggtgacggagccgtggggaatcgac
ccggcgggaaccgttgcaacacgaattgccgacctgaagccgggcactgcgatcgatctg
gcctgcggcgacggccgtcacgcgcggtggatggccgggcaagggtggtcggtgactgcc
gtcgactactcgtcggtggcgatcgatctggcacgggcgagtgacttggacaaggctgtc
gactggcaggtcggcgacgcgaccacgtggcaaccggaaggggtagttgacctggtgttg
gtcagctttcttcacctcgaggtcgacgagctggccgacacgctcaaacgcgtcggggag
tggctgacgccaggcgggcgcgtcctctatttggggcattcgatcgagaacttccaccgt
ggtgtgggcggcccacccgaaccgaccattctgcccggtatttccgatctcgctcgcgcc
gcggagggatcgagggtctacgccctcgaacatgtcgttcggccgcaggacggtaagacg
gcaatcgacgttttgctcgaattcggtccgtgggaacaggtctga

DBGET integrated database retrieval system