KEGG   Rhodococcus erythropolis CCM2595: O5Y_06255Help
Entry
O5Y_06255         CDS       T02806                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00220  Arginine biosynthesis
rey00250  Alanine, aspartate and glutamate metabolism
rey00290  Valine, leucine and isoleucine biosynthesis
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
rey01130  Biosynthesis of antibiotics
rey01210  2-Oxocarboxylic acid metabolism
rey01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O5Y_06255
   00290 Valine, leucine and isoleucine biosynthesis
    O5Y_06255
   00220 Arginine biosynthesis
    O5Y_06255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rey01007]
    O5Y_06255
Enzymes [BR:rey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     O5Y_06255
    2.6.1.66  valine---pyruvate transaminase
     O5Y_06255
Amino acid related enzymes [BR:rey01007]
 Aminotransferase (transaminase)
  Class I
   O5Y_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_MocR Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGT91122
LinkDB All DBs
Position
complement(1353274..1354527)
Genome map
AA seq 417 aa AA seqDB search
MSTPEPVRHRQPQRELEQSSKLQNVLYEIRGPVHAHAARLEAEGHRILKLNIGNPAPFGF
DAPDVIMRDMIAALPYAQGYSESKGILSARRAIVTRYELVPGFPELDVDNIYLGNGVSEL
ITMTMQALLNNGDEVLIPAPDYPLWTAMTSLSGGTPVHYLCDEANDWNPDIADIESKITD
KTKALLVINPNNPTGAVYSMEVLQQLVDLARKHQLLLLADEIYDKILYDDAKHISLATLA
PDLLCLTFNGLSKAYRVAGYRSGWVAITGPKDHAAGFLEGLDLLASTRLCPNVPGQHAIQ
VALGGHQSIEDLILPGGRLLEQRDVAWERLNMIPGVSCVKPRGALYAFPRLDPNVYEIHD
DEKLVQDLLLQEKILMVQGTGFNWPNHDHLRIVTLPWARDLAVAIERFGNFLTSYKQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacaccagaacccgtccgccatcgtcagccgcagcgcgagctggagcagtcgtcg
aagctccagaacgtcctgtacgaaatccgtgggccggtgcacgcgcatgccgcccggttg
gaggcggaaggacaccggatcctcaagctcaacatcggcaacccggcaccgttcggattc
gatgctcccgatgtgatcatgcgcgacatgatcgccgccctgccctatgcgcagggctat
tcggagtcgaagggaattctgtcggcgcggcgcgcaatcgtgacgcgttacgagctggtt
cccggcttccccgagctcgacgtcgacaacatctacctcggtaacggtgtttccgagctg
atcacgatgaccatgcaggccctcctcaacaacggggacgaggttctgatcccagcgccg
gactacccgctgtggactgcgatgacgagcctgtccggaggcacgcccgtccactatctc
tgcgacgaggccaacgactggaatcccgatatcgccgatatcgaatccaagatcaccgac
aagaccaaggctctcctcgtcatcaacccgaacaaccccacgggtgcggtgtactccatg
gaggttctgcagcagttggtcgatctggcacgcaagcatcagcttctgctgctcgccgac
gagatctacgacaagatcctctacgacgacgcaaagcacatctcgctggcaacgcttgcc
cctgatctgctgtgcctgacgttcaacggcctctcgaaggcctaccgcgtcgccggctac
cgctccggctgggtggcgatcacgggcccgaaggatcacgccgccggcttcctcgaggga
ctcgacctcttggcgtcgacccgcctgtgccccaacgtccccggacagcacgccattcag
gtcgccctcggcggacaccagagcatcgaagacctgatcctgcccggcggtcgcctgctc
gagcagcgcgacgtcgcgtgggagcgattgaacatgattccgggtgtttcgtgtgtgaaa
ccccgcggtgcgctctacgcgttccctcgtctggatccgaacgtctacgagatccacgac
gacgagaagttggttcaggacctgcttctccaggagaagatcctgatggttcaaggcacc
ggattcaactggccgaaccacgatcaccttcggatcgtcacccttccgtgggcccgggat
ctcgccgtggccatcgagcgattcggcaacttcctcaccagttacaagcagtga

DBGET integrated database retrieval system