KEGG   Rhodococcus erythropolis CCM2595: O5Y_07010Help
Entry
O5Y_07010         CDS       T02806                                 

Definition
(GenBank) thiamine biosynthesis oxidoreductase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_07010
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     O5Y_07010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 3HCDH_N AlaDh_PNT_C 2-Hacid_dh_C GIDA
Motif
Other DBs
NCBI-ProteinID: AGT91273
LinkDB All DBs
Position
1511623..1512702
Genome map
AA seq 359 aa AA seqDB search
MSTHARTVSVVGGGVIGLAIAWRAVRDGWSVRLYDPSIGSGASWVAGGMLAPLSEGWPGE
ETALTVGAASLARWPTFGEELGKFGPSVFTADSSLTVALDAADAQDLQTIAEWVTAQGHE
LEVLGRARIRELEPMLGRGIRSGLMAVGESAVDNRLLLEALQKACAESGVELIARAVNDL
AELDTDQIVLTAGIASPKLWPGLPVRPVKGEILRLRSRPGVTPAPSRTIRGSVHGRPAYL
VPRGDGIVVGATQYESGEDTQVTMAGVRDLINDAEALMPAIGEYELYECAAGLRPMTPDN
LPLIGRVSDRVVVSTGHGRNGVLLTPVTADATVALLNGTSLVEVKGTEPERFAVVKENS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacacacgctcgtacggtgtcggttgtcggcggcggtgtcatcggtctcgccatt
gcgtggcgagcagtccgcgacgggtggtccgttcggttgtacgacccgtccattggatca
ggtgcttcgtgggtggcgggcggaatgctcgccccgctttccgaaggctggccgggtgaa
gagacagcgttgacggttggtgcagcgtccctggcacggtggccgacgttcggtgaggag
ctcggaaagttcgggccatcggtcttcaccgcggacagttcgctgacggttgcactcgat
gcggccgacgcgcaggacctgcagaccatcgccgagtgggtgaccgcgcagggccatgaa
ctcgaagttctcggtcgcgcccgcatccgcgaactcgaaccgatgctcggccggggcatc
cggtcgggactgatggctgtcggtgagtccgccgtcgacaacagacttctgctggaggcg
ttgcagaaggcctgtgcggaatccggcgtcgaattgatcgcgcgtgccgtcaacgacctc
gccgaactcgacaccgatcagatcgtgctcaccgccggtatcgcgtcacccaagctgtgg
cccgggttaccggtacgcccggtcaagggcgaaatccttcgcctgcggagtaggcctgga
gtcaccccggcgcccagccgcaccatccgcggaagcgtccacgggcggcccgcctacctc
gtcccgcgcggtgacggaatcgtcgtcggcgcaacacaatacgagtccggtgaggacacg
caggtcacgatggccggagtacgcgacctgatcaacgacgccgaggcactgatgccggcg
atcggcgaatacgaactgtacgaatgcgcggcaggcctgcgtcccatgacgccggacaac
ctgccgttgatcgggcgcgtgtccgatcgtgttgtcgtctccaccggacacggacgcaac
ggtgtcctgctgacgcctgtcaccgccgatgcgacggtcgcgttgctgaacggcacatct
ttggtcgaggtaaaaggaaccgaacccgagcggttcgcagtagttaaggaaaattcatga

DBGET integrated database retrieval system