KEGG   Rhodococcus erythropolis CCM2595: O5Y_07020
Entry
O5Y_07020         CDS       T02806                                 

Gene name
thiG
Definition
(GenBank) thiazole synthase
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_07020 (thiG)
Enzymes [BR:rey01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     O5Y_07020 (thiG)
SSDB
Motif
Pfam: ThiG His_biosynth FMN_dh IMPDH NanE Dus
Other DBs
NCBI-ProteinID: AGT91275
LinkDB
Position
1512907..1513659
AA seq 250 aa
MAEQDLLTIAGRTFGSRLITGTGGAANLAVLEEALVASGTELTTVAMRRVDAAGGTGVLD
LLRRLGIEPLPNTAGCRGAAEAVLTAQLAREALETNWVKLEVIADERTLLPDAIELVSAA
EQLVDDGFTVLPYTTDDPVLALRLEEVGCAAVMPLGSPIGTGLGIANPHNIEMIVERAGV
PVILDAGIGTASDATLAMELGCDAVLLATAVTRAKNPALMASAMRHAVVAGFEARHAGRI
PKRFWAQASS
NT seq 753 nt   +upstreamnt  +downstreamnt
gtggctgagcaggaccttctcactatcgctggccgcaccttcggttcccggctcatcacc
ggaacaggcggcgccgccaaccttgcggtgctcgaggaagcgcttgtcgcctccggcacc
gaactgaccaccgtcgcgatgcggcgagtcgacgcggccggtggcacgggtgttctggac
ctgcttcgtcgcctcggaatcgaaccgttgccgaacaccgccgggtgtcggggcgccgcc
gaagcggtcctgacggcgcagttggcacgcgaagcgctcgagacgaactgggtcaaactc
gaagtcatcgccgacgagcggacgctgctgcccgacgcaatcgaactcgtctccgccgca
gaacaattggtggacgacggattcaccgttctgccgtacacgacggacgatccggtgctg
gcgcttcgcctcgaagaggttggttgcgccgcggtcatgccgctcggttcacccatcggc
accgggctgggtatcgcgaatccgcacaacatcgagatgatcgtcgagcgcgccggcgta
cccgtcatcctcgacgccgggatcggaacggccagcgacgccacccttgccatggagttg
ggctgcgacgccgtcctacttgcgacagcggtgacgcgggccaagaatcccgcgctgatg
gcgtcggcgatgcgtcacgctgtcgtggcaggtttcgaggcgcggcacgccggccggatc
cccaagcgattctgggctcaagcgtcgtcctga

DBGET integrated database retrieval system