KEGG   Rhodococcus erythropolis CCM2595: O5Y_07050
Entry
O5Y_07050         CDS       T02806                                 

Definition
(GenBank) thiamine biosynthesis protein ThiC
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_07050
Enzymes [BR:rey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     O5Y_07050
SSDB
Motif
Pfam: ThiC_Rad_SAM ThiC-associated
Other DBs
NCBI-ProteinID: AGT91281
LinkDB
Position
complement(1518960..1520591)
AA seq 543 aa
MQEKSVRTAVHATVHTAVTTGPIEGSSKHYVESDSLRIPLRRVTLTNGEHLDLYDTSGPY
TDTDADIDLDAGLPTTRDTWERPESNRTQLECARDGVITPEMRYCAAREGVSAELVRSEV
ARGRAVIPANHRHGELEPMIIGKKFAVKINANIGNSAVTSSVAEEVEKMVWAIRWGADTI
MDLSTGKDIHLTREWILRNSPVPVGTVPIYQALEKVNGDPTALTWEIYRDTVIEQCEQGV
DYMTVHAGVRIGYIALTAGRVTGIVSRGGAIMAAWCMHHRQESFLYTHFDELCEILRRYD
VTFSLGDGLRPGSIADANDAAQFAELRTLGELTQIAKSAGVQVMIEGPGHVPMDKIEENV
RLEEELCDEAPFYTLGPLATDIAPAYDHITSAIGAAMIARAGTAMLCYVTPKEHLGLPNR
DDVKTGVITYKIAAHAADLAKGHPNAQARDDALSKARFEFRWLDQFALSLDPDTAREFHD
ETLPAEPAKTAHFCSMCGPKFCSMRISADVRQYAEILEAEIPETESIRTELPFPQVRSVG
SSS
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgcaggagaagtctgtccgtacggctgttcacgcgactgtccacaccgctgtgacaacc
ggcccgatcgagggcagtagcaagcattacgtcgaatcggattctctccggatcccactt
cgacgcgtcactctcaccaatggtgagcatctggacctgtacgacacgtcaggtccttac
accgacacggacgccgacatcgacctcgatgcagggctcccgacgaccagggacacctgg
gaacgcccggaaagcaatcggacgcaactggaatgcgcccgagacggtgtgatcaccccg
gagatgcgctattgcgctgcacgcgagggcgtttcagccgaactggtgcgttccgaggtg
gctcgcgggcgggcggtaattcccgcgaaccatcgccacggcgagctggagccgatgatc
atcggcaagaagttcgccgtcaagatcaacgcgaatatcgggaactcggccgtaacctcc
tctgttgcagaggaagtcgaaaagatggtgtgggcgatccgctggggcgccgacaccatc
atggacctgtccaccggcaaggacatccacctgacccgtgaatggattctgcgcaactca
cccgtaccggtcggcacggtaccgatctaccaggcactcgagaaagtcaacggagatccc
actgctctgacatgggaaatctaccgcgacacggtaatcgagcagtgcgagcagggcgtc
gactacatgaccgtgcatgccggtgtacgaatcggttacatcgctctgactgctggtcgc
gtcacgggaatcgtctcgcgcggcggcgcgatcatggccgcgtggtgcatgcaccacagg
caggaatcgttcctctacacccacttcgacgaactgtgcgagatcttgcgccgatacgac
gtcacgttctccctcggtgacgggcttcgaccgggatcgatcgccgacgccaacgacgcc
gcccaattcgcggagcttcgcactctgggagaactcacgcagattgcgaaatccgcagga
gtccaggtcatgatcgagggccccggacacgttcccatggacaagatcgaggaaaacgtc
cgcctggaagaagagctctgcgacgaggcaccgttctacaccctcggaccgctcgctacc
gatatcgcgccggcgtacgaccacatcacctccgccatcggtgcggcgatgatcgcacgg
gcgggaacggcgatgctctgttacgtcacacccaaggaacacctcggcctgcccaaccga
gacgacgtgaaaaccggtgtgatcacctacaagatcgctgcccatgcagcagacctggca
aaagggcacccgaatgcacaggcccgcgacgacgcactgtccaaggcgcgcttcgaattt
cgctggttggaccagttcgctttgtcactcgacccggacaccgccagggagttccacgac
gagacactgccggccgagcccgccaagaccgcacatttctgctcgatgtgcgggccgaag
ttctgctcgatgcggatctcggcggacgtacgtcagtacgcggaaatcctggaagcggaa
attccggaaaccgagtccatccggaccgagctgccgtttccccaggtccggtcggtaggc
tcgtcgtcgtga

DBGET integrated database retrieval system