KEGG   Rhodococcus erythropolis CCM2595: O5Y_07220
Entry
O5Y_07220         CDS       T02806                                 

Definition
(GenBank) oxidoreductase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00360  Phenylalanine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    O5Y_07220
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     O5Y_07220
SSDB
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_3 NAD_binding_8 Pyr_redox Amino_oxidase FAD_binding_2 UDPG_MGDP_dh_N AlaDh_PNT_C ApbA 3HCDH_N Thi4 HI0933_like NAD_binding_7 Glu_dehyd_C Pyr_redox_3 TrkA_N XdhC_C 2-Hacid_dh_C Shikimate_DH GIDA Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AGT91315
LinkDB
Position
complement(1555025..1556278)
AA seq 417 aa
MGTRQSPDRVVVVGAGVVGLSTAWFLQERGVEVTVVDRDGVAADASWGNAGWLAPALTLP
LPEPAVLQYGLRAMLSPSSPVYVPLTTDLKLIRFLVGFARHCTPSKWQEAMSVYTEVNRT
ALGAYDELADGGVKELTRLADPFLAAFASEKDRQTLVDEFHHVEAAGGEVDFDLLDYDAI
HSLEPSLGQGVKAGLRLRNQRFIDPPLFVNSLADAVRERGGEIVSGFDVTQIDDRVGGVT
VRSAHGDSRDGDAVVISSGARLNKLSAPFGVRKLVQAGRGYSFSVKPEHLPKNPVYFPTQ
RVACTPLHDRFRVAGMMEFRSPDAPLDPRRVQAIIDAAKPMLSGIDWTAREEEWVGSRPC
TTDGLPLIGATKSPRVHVAGGHGMWGIALGPLTGKMVADSMTGAQTPTVMRHFDPLR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggaactcgtcagagccccgatcgtgtggtcgtggtcggtgcgggtgttgtcggattg
tcgacggcctggttcttgcaggaacgtggagtcgaggtcaccgtcgtcgatcgcgacggc
gtcgcagccgacgcgagctggggcaacgccggttggcttgcccccgcattgacgcttccg
ctgcccgaacccgcagtgctccaatacggcttgcgcgcgatgctcagcccgtcgtccccg
gtgtacgtgccactgaccaccgatctgaagctgattcggttcctggtcgggttcgcgcgc
cactgcacgccgtcgaagtggcaggaagcgatgtcggtctacaccgaggtcaaccgaaca
gccttgggcgcgtacgacgaactcgccgacggtggcgtcaaagagctgacccgcctggcc
gatcctttcctcgccgcgtttgcgtccgagaaggaccgacagactttggtggacgagttc
catcacgtcgaggccgcgggcggcgaggtcgacttcgacctcctcgactacgacgcgatt
cattcgctcgagccttcactcggccagggtgtgaaagccggtttgcgtctgcgtaatcag
cgtttcatcgatcccccattgttcgtgaactcgttggcggacgcggttcgtgaacgcggt
ggagaaatcgtcagcggtttcgacgtcacgcagatcgacgatcgggtcggcggagtcact
gttcgcagtgcacacggtgattcacgcgacggcgacgccgtggtcatctcgagcggtgcc
cgcttgaacaagctctccgcaccgttcggtgtgcgcaaactggtgcaggccggacgcgga
tacagcttcagtgtcaagcccgagcacctccccaagaaccctgtgtatttccccacccag
cgcgtcgcatgcactccgttgcacgatcgcttccgagtcgccggaatgatggaattccgc
agccctgacgcgccgctggatccgcgccgcgtgcaggcgatcatcgatgcggccaagccg
atgctcagcggcatcgactggactgcacgggaagaggaatgggtgggatcacgaccgtgc
actaccgacggcttgccgttgatcggcgccacgaagtcgccgcgggtgcacgtcgccggt
ggtcacggaatgtggggaatcgccctgggtccgttgaccggaaagatggtggccgactcg
atgaccggcgctcagacgccaaccgtcatgcgccacttcgatccgctgcgctga

DBGET integrated database retrieval system