KEGG   Rhodococcus erythropolis CCM2595: O5Y_09005
Entry
O5Y_09005         CDS       T02806                                 

Gene name
adk
Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00230  Purine metabolism
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
Module
rey_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O5Y_09005 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_09005 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rey04147]
    O5Y_09005 (adk)
Enzymes [BR:rey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     O5Y_09005 (adk)
Exosome [BR:rey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O5Y_09005 (adk)
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 Cytidylate_kin AAA_18 Gp_dh_C Thymidylate_kin RuvB_N AAA AAA_28
Other DBs
NCBI-ProteinID: AGT91668
LinkDB
Position
1948102..1948647
AA seq 181 aa
MRLVLLGPPGAGKGTQAAILSEKFGVPHISTGDLFRANIGQATALGVEAKKYIDAGELVP
SSITNDMVKARVAEPDAANGFLLDGFPRSVEQAQALEGILKDLDTKLDGVLSFVVDEDIV
VERMLARGRADDTEDVIRNRLRVYRDETSPLFDYYKDSIVSVDAIGEVEEVNARALAALG
K
NT seq 546 nt   +upstreamnt  +downstreamnt
gtgagacttgtcctccttggtcctcccggtgccggcaagggcacccaggccgctatcttg
tccgagaagttcggcgttccccatatctccacgggtgatctcttccgcgcgaatatcggt
caggccaccgctctcggtgtggaagcaaagaagtacatcgacgccggcgaactcgtaccg
agttcgatcaccaacgacatggtgaaggctcgcgtcgcagagccggacgcagcaaacggt
ttccttctcgacggatttccgcgctcggtcgaacaggctcaggcactcgagggaatcttg
aaggatctcgacaccaagctcgacggtgttctctcttttgtcgtcgacgaggacatcgtg
gtcgagcgcatgctcgcccgcggtcgtgcagacgacaccgaggacgtcattcgcaaccga
ctccgggtctaccgcgacgagacgtcaccgctgttcgattactacaaggacagcatcgtc
tccgtcgacgcgatcggcgaggtcgaagaagtcaacgcacgcgcactggcagcgttgggt
aagtaa

DBGET integrated database retrieval system