KEGG   Rhodococcus erythropolis CCM2595: O5Y_09630Help
Entry
O5Y_09630         CDS       T02806                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00020  Citrate cycle (TCA cycle)
rey00480  Glutathione metabolism
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
rey01120  Microbial metabolism in diverse environments
rey01130  Biosynthesis of antibiotics
rey01200  Carbon metabolism
rey01210  2-Oxocarboxylic acid metabolism
rey01230  Biosynthesis of amino acids
Module
rey_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O5Y_09630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    O5Y_09630
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     O5Y_09630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGT91793
LinkDB All DBs
Position
2084046..2085269
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSAPIEHELVNFPEEGGVVQ
GQYNFTTSIRDFARASLTYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKAEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDSTPEVIGFAQALE
DVVIKTVESGQMTKDLSMLVGGDQGYLTTEEFLGALDVNLQKAMAAK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggcaccgtcgtcgaactcgacggcgatgagatgacgcgc
attatctggcagttcatcaaagacaagttgatccatccgtatctcgatgtgaacctcgag
tactacgacctcggtatcgagtaccgcgacgagaccgacgaccaggtcaccatcgacgca
gcgcacgcgatccagaagcacggcgtcggcgtcaaatgcgccacgatcacgccggacgag
gcacgtgtcgaggaattcggtctcaagaagatgtggcgttccccgaacggaacgatccgc
aacattctcggcggcacgatcttccgcgcaccgatcatcatctccaacgttccgcgactc
gttccgggctggaccaagccgatcatcatcggccgtcacgcattcggcgaccagtaccgc
gccacagacttcaaggtccccggccccggcaaggtgatgatcacctacacgcctgaggac
ggcagcgcaccgatcgagcacgaactggtcaacttccccgaagagggcggcgtcgtccag
gggcagtacaacttcaccacgtccatccgtgacttcgctcgcgcgtcgctcacctacgga
ctgcagcagaactacccggtgtacctgtccaccaagaacaccattctcaaggcgtacgac
ggtgccttcaaggacatcttccagcacgtctacgagaccgagttcaaggctgagttcgat
gccgcaggtctgacctacgagcaccgcctcatcgacgacatggtcgcttccgcactcaag
tgggagggtggatacgtctgggcatgcaagaactacgacggcgacgtccagtccgacacc
gtggcccagggcttcggctcgctcggcctcatgacgtcggttctgctgacaccggacgga
aggacctgtgaggcagaggctgctcacggcaccgtgacgcgtcactaccgtcagcaccag
cagggcaagcccacctcgaccaacccgatcgcgtccatcttcgcgtggacccgcggactc
gagcatcgtggcaagctcgacagcacccctgaggtcatcggcttcgcgcaggcgctcgaa
gacgttgtcatcaagaccgtcgaaagcggccagatgaccaaggacctctcgatgctggtc
ggcggcgatcagggctacctgaccaccgaggagttcctcggtgcactcgacgtgaacctg
cagaaggccatggccgcgaagtag

DBGET integrated database retrieval system