KEGG   Rhodococcus erythropolis CCM2595: O5Y_09950Help
Entry
O5Y_09950         CDS       T02806                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00564  Glycerophospholipid metabolism
rey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    O5Y_09950
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     O5Y_09950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 Thi4 AlaDh_PNT_C Pyr_redox 3HCDH_N HI0933_like Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGT91857
LinkDB All DBs
Position
2148869..2150611
Genome map
AA seq 580 aa AA seqDB search
MSKQQGAQFLGPQQREAAWEQLQTEQFDVVVVGGGVVGVGAALDAATRGLKVALVEARDY
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELSLTTLAPHLVKPLKFLFPLAHRVW
ERPYMAAGIFLYDRMGGAKSVPSQKHLTRAGALRMSPSLKRSSLTGGIQYYDTVVDDARH
TMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDCEDGRTAEVKGHVVINATGVWT
DEIQALSRQRGRFRVRASKGVHIVVPRDRIVSEAAIILRTEKSVLFVIPWGSHWIIGTTD
TDWNLDLAHPAATKADIDYILGHVNSVLVTPLTHADIDGVYAGLRPLLAGESDETSKLSR
EHAVARVAPGLVAIAGGKYTMYRVMAEDAVDVAAEDIPARVASSITEKVPLVGADGYFAL
INQTVQLGEQYGLHPYRVKHLLDRYGSLITEVLELGRQTPELLQPITDAPDYLQVEAVYA
AAAEGALHLDDILARRTRIAIEYPHRGVNCAQQVAGLVAPILGWDAATVEREVDTYRARV
EAEIESQTQPDDESADALRAAAPESRAEILEPVVVVPDRV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagcagcaaggtgcgcagtttctcggcccgcagcagcgtgaagctgcttgggaa
cagcttcagaccgagcaattcgacgtcgtcgttgtcggcggcggtgttgtcggtgtcggg
gctgcgctcgatgcggccacccgcggactcaaggttgcgttggtcgaggcccgtgactac
gcatccggcacgtccagtcgctcgtcgaagatgttccacggcggtctccgctatctagag
caactcgaattcggcctcgttcgtgaagcattgcgtgagcgcgaactctcgctgaccacg
ctcgctccgcacctggtcaagccgctgaagttcctgttccctctggctcaccgagtgtgg
gagcgcccgtacatggcggcgggaatcttcctctacgaccgaatgggcggcgcaaagtcg
gtcccctcccagaagcacttgacgcgggcgggcgcgctacgcatgtcgccgagcctcaag
cgcagttcgctgaccggtggcatccagtactacgacaccgtcgtcgacgacgctcggcac
accatgaccgtcgcacggaccgctgcacactacggcgcggtcgtccgaacgtcgacgcag
gtcgtcggctttctgcgggaagcggatcgggtctcgggagttcgtgttcgggactgcgaa
gacggccgtaccgccgaggtcaagggtcacgtcgtcatcaatgcgaccggtgtctggacg
gacgagatccaagcgctctcacgtcagcgcggacggttccgggtgcgagcgtcgaagggc
gtacacatcgtcgtcccgcgcgatcgcatcgtcagtgaagccgccatcatcctgcgtacc
gagaagtcggtgctgttcgtcattccgtggggcagtcactggatcatcggcaccactgat
accgactggaacctggatctcgcacatccggcggcaaccaaagcagatatcgactacatc
ctcggccacgtgaactccgtcctggtcacgccgttgacgcacgccgacatcgacggtgtg
tacgccggcctgcgcccgctgcttgccggtgaaagcgacgagacgtcgaagctctcgcgc
gagcacgccgttgcccgtgtggctccaggtctggtcgccatcgccggcggaaagtacacg
atgtatcgggtcatggcggaagacgccgtcgacgtcgcagcagaagacattccggcgcgg
gttgcgtcgtcgatcacggagaaggtaccgctcgtcggcgccgacggatacttcgcgttg
atcaaccagaccgtgcaactgggcgagcagtacggcttgcatccgtatcgcgtcaagcac
ctgctcgaccgctacggttcgctcatcaccgaggtcctcgaactcggccggcagacaccg
gagttgttgcagcccatcacggacgcgcccgattaccttcaggtcgaagctgtgtacgcc
gccgcggccgagggggcactgcacctcgacgacattctggcccgccgtacgcgtatcgca
atcgaatatccgcatcgtggtgtcaactgcgcacagcaggtcgccggattggttgccccg
attctcggttgggatgccgccaccgtcgaacgcgaagtcgacacgtaccgagcgcgtgtc
gaagccgaaatcgagtctcagacccagccggacgacgagtcggcggacgcattgcgcgcc
gcagcgccggagtcgcgggccgagatcctcgagcccgtcgtcgtggtgccggatcgggtc
tga

DBGET integrated database retrieval system