KEGG   Rhodococcus erythropolis CCM2595: O5Y_10845
Entry
O5Y_10845         CDS       T02806                                 

Definition
(GenBank) hypothetical protein
  KO
K06954  uncharacterized protein
Organism
rey  Rhodococcus erythropolis CCM2595
Brite
KEGG Orthology (KO) [BR:rey00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    O5Y_10845
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 Thi4 HI0933_like FAD_oxidored MCRA AlaDh_PNT_C GIDA FAD_binding_3
Other DBs
NCBI-ProteinID: AGT92034
LinkDB
Position
2338164..2339444
AA seq 426 aa
MSSDKRKVAVVGSGVAGLTAAWVLSKDSDVTLYEADSRLGGHADTHSVTDPEGRSLAIDT
GFIVHNDRTYPTLLRLFAELDVPTQESDMSMSVRCGGCGLEYSGGQGLRGVLPTPGLLVN
GSFLSMLMEVKRFHRRARALLDNTDPSAPDQTLGVFLRSGRFSDYFTAHFMTPLVSAVWS
CDPGSALKYPARYLFSFLDHHGMLSVTGSPTWRTVTGGSGEYVRLVAKSIGDIRLNTPVR
AVHRFDDRVDIRDGDDQIQTFDAVVVATHPQQALKILADPTPAESQVLGAMPYSVNHTQL
HTDENVLPGNTNARASWNYYIPECNAKPDHVLVSYDMTRLQRLPETGRRYLVTLGGDEMV
SPDSVIDQMTYEHPQYTPTSVAAQARLPELDSDVLAFAGAYHGWGFHEDGALSGLRAAER
VGGRWP
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagttccgacaagcgcaaggtggccgtcgtcggtagtggtgtcgcaggtctgacagcg
gcgtgggtgctcagtaaggacagtgacgtcaccctctacgaagcggattcacggctcggc
gggcacgcggacacccattcggtcaccgacccggaagggcgaagcctcgccatcgacacg
gggttcatcgttcacaacgatcgcacctatccgacattgttgcgattgttcgcagaactc
gatgtgcctacgcaggaatccgacatgagtatgtcggtcaggtgtgggggttgcggtctc
gagtactcgggaggccaagggttgcgcggcgttctcccgacgccggggctccttgtcaac
ggcagctttctgtcgatgttgatggaggtcaagcgcttccatcgccgtgcccgcgccctg
ctcgacaacacggatccgtcggcacccgaccagacactgggagtgtttctgcgcagcggc
cggttctccgactacttcaccgctcacttcatgactccgctcgtgtcggcagtctggtcg
tgtgaccccggctcggcgctgaagtatcccgcgcggtacctgttctcgttcctcgatcac
cacggaatgctgagcgtcactggatcgccgacctggcgaacagtcaccggtggatcgggc
gaatacgttcgtctcgtcgccaaaagtatcggggatatccgcctgaacacgccagttcgc
gccgtccaccggttcgacgatcgcgtcgacattcgtgacggcgacgaccagatccagacc
ttcgacgcagttgtggtcgcaacgcatccgcagcaagcactgaagattttggcggatccg
acgcctgccgaatcccaggtcctcggcgcaatgccgtactccgtcaaccacacccaactt
cacacggacgaaaatgtgctgcccggcaacaccaatgcgcgcgcgtcgtggaactactac
atccctgaatgcaacgcgaagccggatcacgttctggtcagctacgacatgacgaggttg
cagcggctgccggagaccggtcggcgctacctggtgacgttggggggagacgaaatggtg
tccccggactcggtgatcgatcagatgacctacgagcatccgcagtacacacccacctcc
gtcgccgctcaagcgcggcttcccgagttggactcggacgtgctcgcgtttgccggtgcg
taccacggatggggtttccacgaggacggtgcactgtctggcctgcgtgccgccgaacgc
gtcggaggtcggtggccgtga

DBGET integrated database retrieval system