KEGG   Rhodococcus erythropolis CCM2595: O5Y_11140
Entry
O5Y_11140         CDS       T02806                                 

Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
rey04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_11140
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    O5Y_11140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rey03016]
    O5Y_11140
   03029 Mitochondrial biogenesis [BR:rey03029]
    O5Y_11140
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rey02048]
    O5Y_11140
Enzymes [BR:rey01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     O5Y_11140
Transfer RNA biogenesis [BR:rey03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    O5Y_11140
 Prokaryotic type
    O5Y_11140
Mitochondrial biogenesis [BR:rey03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    O5Y_11140
Prokaryotic defense system [BR:rey02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   O5Y_11140
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-ProteinID: AGT92092
LinkDB
Position
2397624..2398853
AA seq 409 aa
MTLPAPSAHAGFPVYLDHAATTPMSAAAIEAMTDTFKTVGNASSLHGSGRAARRRVEESR
ESIAASLGARPSEVIFTSGGTESDNLAVKGIYWARRDADPRRTRILASSVEHHAVLDAVE
WLEQHEGARVTWLPVDENGVVDPRTLRDELSVHADEVALVTVMWANNEVGSIMPIVELAE
ISAEFEIPMHSDAVQAVAQLPVDFAASKLSALSIAAHKFGGPHGVGALLLGRQVPCVPLL
HGGGHERDLRSGTPDTAGVVGMAAALRANVENFDSSTRELAQLRDRLIDGVLEILPESVL
NGPTGSDRLPGNAHFTFPGCEGDSLLMLLDAAGIECSTGSACTAGVARASHVLIAMGVES
PVARGSLRFSLGHTSSVTDVDALIAALPQVVERARAAGLAGAGSRGGDR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgactctgcctgcacccagtgcccacgccggatttccggtgtacctcgatcatgccgcc
acgactccgatgtcggcagccgctatcgaggcgatgaccgataccttcaaaaccgtgggc
aacgcgtcctcgctgcacggttccggccgtgcggcccggcgccgcgtcgaggagtcgcgg
gaatcgatcgctgccagcctgggtgcgcggccttcggaggtcatcttcacctccggcgga
accgagagcgacaatctcgcggtcaagggcatctactgggctcgccgtgacgccgatccg
cgacgcactcgcatcctggccagctccgtcgagcatcatgcggtgctcgacgccgtcgag
tggctcgagcagcacgagggtgcgcgcgtgacgtggttgccggtcgacgagaacggtgtc
gtcgacccgcggaccctgcgcgacgagctttccgtccacgccgacgaggtagcactcgtt
acggtgatgtgggccaacaacgaggtcggctccatcatgccgatcgtggagttggcggag
atttcggctgagttcgagattccgatgcacagcgacgcggtccaggccgttgcgcaattg
ccggtcgatttcgcggcgagcaagttgtccgcgctgagcatcgcggcgcacaagttcggt
ggtccgcacggcgtcggcgcactgctgctcggacgccaggttccgtgtgtgccgctcctt
cacggcggcggacacgaacgtgatctgcgttcgggcactccggatactgcgggcgttgtc
gggatggctgcggcgctgcgcgcaaacgtcgagaacttcgattccagcacaagggaattg
gcgcagttgcgtgaccgtttgatcgacggagtcctggagattcttcccgagtcggtgctc
aacggcccgaccggatccgatcggcttcccggtaacgcgcacttcaccttccccggctgc
gagggcgattcgttgctgatgctgctcgacgccgccggtatcgaatgttccaccggttcg
gcgtgcaccgccggtgtggccagagccagccatgtcttgatcgcgatgggcgtcgaatcg
cccgtcgcgcgtggctcactgagattttcgctcggacatacgtcgagtgtcaccgatgtg
gacgcgctgatcgctgcgcttccacaagtagtagagcgcgctcgggccgccggtcttgcc
ggtgccggttcgcgtggaggggatcgctga

DBGET integrated database retrieval system