KEGG   Rhodococcus erythropolis CCM2595: O5Y_11345Help
Entry
O5Y_11345         CDS       T02806                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00473  D-Alanine metabolism
rey00550  Peptidoglycan biosynthesis
rey01100  Metabolic pathways
rey01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    O5Y_11345 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O5Y_11345 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    O5Y_11345 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rey01011]
    O5Y_11345 (ddl)
Enzymes [BR:rey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     O5Y_11345 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rey01011]
 Precursor biosynthesis
  Amino acid ligase
   O5Y_11345 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp RimK ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGT92131
LinkDB All DBs
Position
2443791..2444876
Genome map
AA seq 361 aa AA seqDB search
MAVIFGGRSNEHSVSCVSAGSVLSNLDPDRYDVVPIGITVDGSWVLGSSDPSSLAISGRA
LPSVDKDGTSVVLSADPTREGEVISFDGSDAGAVLASVDVVFPVLHGAYGEDGTIQGLLE
LAGVPYVGPGVLASAAGMDKEFTKKLLAAEGLPVGVQVVLRPGIATLTEEQKAELGLPVF
VKPARGGSSIGITRVSNWDGLDGAIAHARLHDPKVIVEGAIIGREVECGVLEFPNGDVKA
SVVAEIRMPDSDTDSDAFYDFDTKYLDDVCEFDIPAKLDESVSDQIRELAVRAFKALDCQ
GLSRVDFFVTADGPVINEINTMPGFTSISMYPKMWNATGIDYRTLISTLVDTAIARGTGL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtgatcttcggtggccggagcaatgagcattcagtgtcctgtgtttccgccgga
agcgtcctgagcaacctcgacccggatcggtacgacgtcgtaccgatcggcatcacagtc
gacggttcctgggtcctcgggtcgagcgaccccagctccctcgcgatcagcgggcgcgcg
ttgccgtcggtcgacaaagacggaacgtcggtggtcctcagcgcggaccccacccgcgag
ggcgaggtcatctccttcgacggctccgacgccggtgctgtgctcgcgtcggtcgacgtc
gttttccccgttctgcatggggcttacggcgaagacggcaccattcagggattgctcgaa
cttgccggggttccgtatgtcggacccggagtcctggccagcgccgccggcatggacaaa
gagttcacgaagaagcttcttgccgctgaaggacttcccgtcggagtgcaggtcgtgctt
cgaccgggaatcgcaacgctgaccgaagagcagaaggcggagttgggccttcccgtgttc
gtgaagcccgctcgtggtggttcgtccatcggcatcacccgggtgagcaattgggacggt
ctggacggggcgatcgctcatgcgcgcctgcacgatcccaaggtgatcgtcgaaggcgcg
atcatcggccgtgaggtggaatgcggcgtcctcgaattcccgaacggtgacgtcaaggcg
agtgtggtcgctgagatccggatgccggattccgacaccgattcggacgcgttctacgac
ttcgacaccaagtacctcgacgacgtctgcgaattcgacatccccgcgaaactcgacgag
tcggtgagcgaccagatcagggagcttgcagtccgcgcgttcaaggcactcgattgccag
ggactctcgcgggtcgatttcttcgtcacggctgacggcccggtgatcaacgagatcaac
acgatgcccgggttcacttccatctcgatgtatccgaagatgtggaacgccaccggaatc
gattaccgcactttgatttcgacactggtcgacaccgccatcgctcgcggtaccggactt
cgctga

DBGET integrated database retrieval system