KEGG   Rhodococcus erythropolis CCM2595: O5Y_12965Help
Entry
O5Y_12965         CDS       T02806                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00010  Glycolysis / Gluconeogenesis
rey00520  Amino sugar and nucleotide sugar metabolism
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
rey01120  Microbial metabolism in diverse environments
rey01130  Biosynthesis of antibiotics
rey01200  Carbon metabolism
Module
rey_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O5Y_12965
   00520 Amino sugar and nucleotide sugar metabolism
    O5Y_12965
Enzymes [BR:rey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     O5Y_12965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGT92454
LinkDB All DBs
Position
complement(2787193..2787960)
Genome map
AA seq 255 aa AA seqDB search
MTTTGFGIDVGGSGVKGGTIDLSTGEMIGDRIKILTPQPSTPDAIAGTVAEIVEQAKWTG
PVGITLPAVVTGGVARSAANIDKSWIDTDAAALFGKALGGREVTVLNDADAAGIAEDSFG
AGKDTSGVVILLTFGTGIGSAVLHNGVLLPNTEFGHLEVDGKEAEHRAASSVKEKKDWSY
KEWAVEVSRVLTTFENLLWPDLFIAGGGISRKHEKWIPHLTNRTKVVPATLLNTAGIAGA
ALASVGLTRPAPVAG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacaggtttcgggatcgacgtcggcggcagcggcgtcaagggcggcacgatc
gacctgagcaccggggaaatgatcggtgaccgcatcaagatcctgaccccgcagccgtcc
actcccgatgcgatcgcgggcactgtggccgagatcgtcgagcaggcaaagtggaccggg
ccggtcggcatcacgttgcccgctgtcgtgaccggcggcgtcgcgcgcagcgccgcgaac
atcgacaagtcctggatcgacaccgacgcggccgcgctcttcggcaaggcgctgggcggg
cgcgaagtcaccgtcctcaacgacgccgacgccgccggaattgccgaggactcgttcgga
gcgggcaaggacacctccggcgtcgtgatcctcttgaccttcggcaccggaatcggatct
gccgtgttgcacaacggagttctgttgcccaacaccgagttcggccacctcgaggtcgac
ggcaaggaagccgagcatcgagcggcgtcgtcggtgaaggaaaaaaaggactggagctac
aaggagtgggcggtcgaggtctcccgagttctgaccaccttcgagaacctgctgtggcct
gatctcttcatcgccggaggcggaatcagccgcaagcacgagaagtggattccgcacctg
accaaccgcacgaaggtcgtccccgccaccctcctgaacaccgcgggaatcgccggagct
gcgctcgcgtcggtcggactgaccaggccggcccccgtcgccggatga

DBGET integrated database retrieval system