KEGG   Rhodococcus erythropolis CCM2595: O5Y_13060
Entry
O5Y_13060         CDS       T02806                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey00900  Terpenoid backbone biosynthesis
rey01100  Metabolic pathways
rey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_13060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O5Y_13060
Enzymes [BR:rey01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     O5Y_13060
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh PFOR_II
Other DBs
NCBI-ProteinID: AGT92473
LinkDB
Position
2804809..2806755
AA seq 648 aa
MGVLARIQGPDDLRQLSHAEMTELADEIREFLVLKVAATGGHLGPNLGVVELTLALHRIF
DSPQDAIIFDTGHQAYVHKILTGRQDQFDTLRKQGGLSGYPCRAESEHDWVESSHASAAL
SYADGLAKAFALTGQNRHVVAVVGDGALTGGMCWEALNNIAAGKDRSVVIVVNDNGRSYA
PTIGGLADHLSALRTAPSYERALDSGRRMVKRLPWVGRTAYSVLHGMKAGLKDAVSPQVM
FTDLGIKYLGPVDGHDEAAMESALRRAKAYGGPVIVHAVTRKGNGYAHAENDVADQMHAT
GVIDPVTGRGTKSSAPDWTSVFSAALIEQASRREDIVAITAAMAGPTGLAAFGEKFPDRI
FDVGIAEQHAMTSAAGLALGGLHPVVAIYSTFLNRAFDQLLMDVALLKQPVTVVLDRAGV
TGVDGASHNGVWDLSLLGIIPGIRVAAPRDADTLREELDEALLVDDGPTVVRFPKGAVPE
AIPAVKRLDGMVDVLKASEGERGDVLLVAVGPFASLALEIAERLDKQGISVAVVDPRWVL
PVADSLVKMADKYALVVTIEDGGLHGGIGSTVSAAMRAAGVHTSCRDMGVPQQFLDHASR
EAIHKELGLTAQDLSRKITGWVAGMGSVGVHVQEDASSASAQGEVAQG
NT seq 1947 nt   +upstreamnt  +downstreamnt
ttgggtgttcttgcccgcattcagggtcctgacgatctacgtcagttgagccacgccgag
atgacggagttggccgacgagattcgtgagttcctcgtgctgaaggtcgctgcgaccggt
ggtcacctcgggcccaacttgggcgtcgtggagttgaccctcgcactgcaccgaattttc
gactcgccgcaggacgcgatcatcttcgacacgggccatcaggcctacgtgcacaagatc
ctcaccggtcgtcaggatcagttcgacactctgcgtaagcagggcggactgtccgggtat
ccgtgccgcgccgagagcgaacacgactgggtcgagtcctctcacgcttccgccgcgttg
tcctatgccgacggcctcgcgaaggccttcgcgctcacgggccagaatcgccacgttgtc
gccgtcgtcggtgacggcgccctgaccggcggaatgtgttgggaagccctcaacaacatc
gcagccggaaaagaccgttcggtggtgatcgtcgtcaacgacaacggccgctcgtacgcg
ccgaccatcggcggcctcgccgaccatctttcggcactgcgcaccgcgccgagttacgag
cgcgccctcgacagtggccgacgcatggtcaagagactgccctgggtggggcgcaccgcg
tactccgtcctgcacggaatgaaggcgggtctcaaggacgctgtcagccctcaggtcatg
ttcaccgatctgggtatcaagtacctcggaccggtcgacggtcacgacgaagccgccatg
gaatcggcgttgcgccgggcgaaggcctacggcggaccggtcatcgttcatgccgtcact
cgtaagggcaacggttacgcacacgccgagaacgacgtggccgaccagatgcatgccacc
ggcgtcatcgatcccgtcaccggtcgcggcaccaagtcgtccgcgccggactggacgtcg
gtcttctcggccgcattgatcgagcaggcttcgcgtcgtgaggacatcgtcgccatcacc
gcggcgatggccgggcccaccggcctcgcggccttcggggagaagttccccgatcggatt
ttcgacgtcggtatcgccgagcagcatgcgatgacctcggccgccggtcttgcacttggt
ggacttcaccccgtcgttgctatctactcgaccttcctcaatcgggctttcgaccagttg
ttgatggacgtcgcactgctcaaacaaccggtgacagtcgtgctcgaccgcgccggggtc
accggagtcgacggcgccagccacaacggcgtctgggatctttcgctgctcggaatcatc
ccggggattcgcgtcgcggcaccgcgtgatgcagacacactgcgggaagaactggacgag
gcgcttctcgtcgacgacggcccaacggtcgtacggttcccgaagggtgctgtacccgaa
gcgattccggcagtgaagcgactcgacggaatggtcgacgttctcaaggccagcgagggt
gagcgcggcgacgtgctcctcgtcgcggtgggcccgtttgcatccttggcactggagatt
gccgagcggctcgacaagcagggcatctcggttgccgtcgttgatccgcgatgggttctg
ccggtcgcggattcgctggtgaagatggcggacaagtacgcccttgtggtcaccatcgaa
gacggcggtctgcacggcggcatcggttcgacggtctcggccgcgatgcgtgccgccgga
gtgcacacgtcgtgccgcgacatgggcgttccccagcagttcctcgatcacgccagccgc
gaagccatccacaaggaactcggactcacggctcaggacctctcccgcaagatcaccggc
tgggtggcggggatgggcagcgtcggcgtccacgtccaggaagacgcgtcgtcggcttcg
gctcagggcgaagtcgcgcaaggctga

DBGET integrated database retrieval system