KEGG   Rhodococcus erythropolis CCM2595: O5Y_16705
Entry
O5Y_16705         CDS       T02806                                 

Definition
(GenBank) hydroxyethylthiazole kinase
  KO
K00878  hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_16705
Enzymes [BR:rey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     O5Y_16705
SSDB
Motif
Pfam: HK DLH
Other DBs
NCBI-ProteinID: AGT93188
LinkDB
Position
complement(3673696..3674541)
AA seq 281 aa
MSDTVSVETVASAIDALRDQVPLVQSLTNIVSANFLTNVLLAAGASNAHIDNVHEAGGFA
AVAGGVLVNLGTPDDGTAEAFLIAAEAARTAGTPWVLDPVGVGGLPWRSGIAVDLLRFHP
SAIRGNASEIIALAGLGGDTRGVDSASDSADAVPAALSLLKHADAVSASGPVDYIVGRDG
GGDVRGIRVSGGSALLPRVTSTGCSLGGLVAAYLAVTPTALDGLVAAHTHVAVASEIAEE
NASGPGSFAVAYLDALYNVNADTIRSRARIESFDLPAGVQN
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctgacactgtctctgtcgaaaccgtcgcgtcggcgatcgacgcactccgcgatcag
gtaccgctcgtccagtcgctgacgaacatcgtttcggcgaacttcttgaccaatgttctg
ctcgctgccggcgcaagcaacgctcacatcgacaacgttcatgaagcgggtgggttcgct
gccgttgccgggggagtgctcgtcaacctcggaacgccggacgacgggacagccgaagcc
ttcctgatagccgcagaagcggcccgaactgccggtacgccatgggttttggatccagtc
ggtgtcggcggactaccctggcggagcggtatcgctgtggatctgctgcgctttcacccc
agcgccatccgcgggaacgcatcggagatcatcgctctggccggactcggcggtgacacc
cgcggcgtcgacagtgcctccgactccgccgacgcagtgcccgccgctctgtcacttctg
aagcatgcggatgccgtgtcggcatcaggcccggtcgactacatcgtcggccgcgatggt
ggcggcgacgttcggggtatccgagtctccggtggcagcgctctgttgccgcgcgtgacc
agtaccggttgctctctgggaggcctggtcgctgcctacctcgccgtgacgccgaccgcg
ctggacggattggttgccgcgcatacgcatgttgccgtggcatcggagatcgccgaggaa
aatgcctcaggtcctggttctttcgcggtcgcgtacctcgacgcgctctacaacgtgaat
gcggacaccatccgctcacgtgcccgaatcgaatcgttcgacctgccggctggagtgcag
aactga

DBGET integrated database retrieval system