KEGG   Rhodococcus erythropolis CCM2595: O5Y_18600
Entry
O5Y_18600         CDS       T02806                                 

Definition
(GenBank) thiamine metabolism protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_18600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rey03000]
    O5Y_18600
Enzymes [BR:rey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     O5Y_18600
Transcription factors [BR:rey03000]
 Prokaryotic type
  Other transcription factors
   Others
    O5Y_18600
SSDB
Motif
Pfam: TENA_THI-4
Other DBs
NCBI-ProteinID: AGT93551
LinkDB
Position
4085437..4086180
AA seq 247 aa
MATTQPAYNSAENSVATAPSTDRFTDRLWAETKVLRESIDSLEFLKRLGDGTLPLDAFRT
YIEQDKLYLEGYSKALSLVAAHAPDPQSAGFWSNSASTAATVESALHDGLLTGGILPAGS
GRLEHSQACLGYVSYLTATAATAPYPVSAAAVLPCFWIYAEVGRDLAASAREVLDADPSH
PYAQWVTTYDAPEFHESVAQARVLVDAAAEAATETEREAMSEAFRIASRYELMFWDSALH
QQPWPAS
NT seq 744 nt   +upstreamnt  +downstreamnt
atggctactacgcagcctgcatacaattctgccgaaaactcggtggccacagcgccgtcg
acggatcggttcaccgatcgactctgggccgagacgaaggtcctccgcgagtcgatcgac
tcactggagttcctcaaacgcctcggcgacggaacattgcctctcgacgcgttccgcacg
tacatcgagcaggacaagctttatctcgaggggtattcgaaagcgttgtccctggtcgcg
gcccacgccccggatccgcagtccgcgggcttctggtcgaattccgcgtccacggcagcg
acagtggaatctgcgcttcacgacggacttctcaccggtggaattcttccagcgggatcg
ggaaggctcgagcattcgcaggcctgcctgggatacgtctcgtatctgacggcgactgcg
gcaactgcgccttacccggtctccgcagcggcagtactcccctgcttctggatctacgcc
gaggtcggccgcgatcttgccgcttcagcgcgcgaggtactcgacgccgatccgtcgcat
ccgtacgcacagtgggtcacgacgtacgacgcacccgaattccacgagtcggtggcgcag
gcccgcgtactggtcgatgctgcggccgaagcggccaccgagacagagcgtgaggcgatg
agtgaagcattccgcatcgccagtcggtacgagttgatgttctgggattccgcactccac
cagcagccttggccggcgtcgtga

KEGG   Rhodococcus erythropolis CCM2595: O5Y_25020
Entry
O5Y_25020         CDS       T02806                                 

Definition
(GenBank) hypothetical protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00730  Thiamine metabolism
rey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    O5Y_25020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rey03000]
    O5Y_25020
Enzymes [BR:rey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     O5Y_25020
Transcription factors [BR:rey03000]
 Prokaryotic type
  Other transcription factors
   Others
    O5Y_25020
SSDB
Motif
Pfam: TENA_THI-4 Vir_act_alpha_C
Other DBs
NCBI-ProteinID: AGT94821
LinkDB
Position
complement(5457662..5458288)
AA seq 208 aa
MSRSSDLLARQQSNLAAARAVPFIEDTIGGTLSDEGFRRYLVIEEAFVLTAVKVLGLVVA
ESPTLDDALDHVTSMSNLVGEQREYFAQLRSRFPYAGDAAALVEESSVLSTRALTLAGEE
GRAAALVGMYAAETLYLSWCREAAAVNVEREPALQDWVDMHVAPPFVSQVAVLACEVDAM
PESVTDEDLDRWFSGMLAAEIDFHNVAV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagtcgctcctcagacctgctcgcgcggcagcagagtaatctcgctgccgcgcgggcg
gttccattcatcgaggacaccatcggcgggacgttgagtgatgagggattccgccggtac
ctcgtgatcgaagaggcattcgtactgacggccgtcaaggtgttggggttggtggtcgcc
gaatccccaacgctcgacgacgcgctcgaccacgtgacgtcgatgtcgaacctggtgggc
gaacagcgcgagtatttcgcgcagttgcgttcccgcttcccgtacgcgggcgacgcagcg
gctctggtcgaggagtcgtctgtgctgtcgacgcgtgccttgaccctcgctggcgaagag
ggcagggcggcggccctggtgggcatgtacgccgcggaaaccctgtatctgtcgtggtgt
cgggaggcggcggcagtgaacgtagagcgcgaaccagcgttgcaggactgggtagacatg
catgtcgctccgccgttcgtatctcaggtggcggtgctggcgtgcgaggtggacgccatg
cccgagtccgtcaccgacgaggacctggatcggtggttctccggcatgctggccgcagag
atcgattttcacaacgtggcggtgtga

DBGET integrated database retrieval system