KEGG   Rhodococcus erythropolis CCM2595: O5Y_18700Help
Entry
O5Y_18700         CDS       T02806                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    O5Y_18700
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     O5Y_18700
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     O5Y_18700
    1.1.1.-  
     O5Y_18700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AGT93571
LinkDB All DBs
Position
4102721..4103776
Genome map
AA seq 351 aa AA seqDB search
MKAARFHGQKDIRIEEIPEPELRPGTVKLKVAWCGICGTDLHEYLEGPIFISAPGHPHPL
SHENAPVTMGHEFSGTVEEVGEGVTDVEVGENVVVEPYFVCNECAPCKAGNYHLCTKMGF
IGLAGGGGGLSEKVVVDRRWIHKIGNIPLDEAALIEPLSVAHHAVVRSGAESGNVAIVGG
AGPIGLLVAAVLKGLGVTTIVTELSEARKAKALSSGVADYVIDPTTEDVKARVLELSGGI
GADIGFECAGVNAVLDTMLDTVRPAGVVVNVSIWGKPATIDMQKLVLKEIDLRGTIAYVR
DHEAVIKMVQDGVVDLAPFITGRIQLEELISEGFTTLIEHNDTAVKILVRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacggttccacgggcagaaagacatccggatcgaagagatccctgagccc
gaattgcggccaggaacagtcaagctgaaggtcgcatggtgcggaatctgcggcacggat
ctccacgagtacctcgagggaccgatcttcatctccgcacccggacacccgcatccactc
tcacacgagaatgcgccggtcacgatgggccacgagttctccggcaccgtcgaagaggtc
ggcgaaggtgtcacggacgtcgaggtcggtgaaaatgttgtcgtcgagccgtacttcgtc
tgcaacgagtgcgccccgtgcaaggcgggcaactaccacctgtgtacgaagatggggttc
atcggcttggccggcggaggtggcgggctcagcgagaaggttgtcgtcgaccgtcgctgg
atccacaagatcggcaacatcccgctcgacgaggcagctctcatcgaaccgttgagcgtc
gcccatcacgcagtcgtacgcagtggagccgaaagcggcaacgtcgccatcgtgggcgga
gctggaccgatcggactcctcgttgcggcagttctcaagggtctgggtgtcacgacgatc
gtcaccgaactcagcgaagcccgcaaggccaaggccctctccagtggagtcgccgactac
gtcatcgatcccaccaccgaagacgtcaaggcgcgcgtcctcgaactcagcggaggcatc
ggcgcagacatcggcttcgagtgcgcaggcgtcaacgcggtactcgacaccatgctcgac
acggtccggcctgccggagttgttgtcaacgtgtcgatttggggcaagcccgcgaccatc
gacatgcagaagctggtcctcaaggaaatcgacctacgcggaaccatcgcgtacgtacgc
gaccatgaagcggtcatcaagatggtccaggacggtgtcgtcgatctggcgccattcatc
accggtcgtattcagctcgaagagttgatctccgaagggttcaccactctgatcgagcac
aacgacactgcagtcaagattctcgtcaggtcgtaa

DBGET integrated database retrieval system