KEGG   Rhodococcus erythropolis CCM2595: O5Y_23385Help
Entry
O5Y_23385         CDS       T02806                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rey  Rhodococcus erythropolis CCM2595
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGT94495
LinkDB All DBs
Position
complement(5112165..5113610)
Genome map
AA seq 481 aa AA seqDB search
METRVEYTELFIGGEWVTPSGSGVIEVMSPHTERVIGSVPAASTADVDRAVEIARAAFDF
GEWTQTPLADRIAVVTRIKDAILARSEEFAALISRQNGAPASSAMRTQVLGAVAAYGAAC
AVAAQFPFEESRAGVGGPMLIRHEPVGVVAAIVPWNVPQLVIAAKLAPALLSGCAVILKP
APETPLDSNLLAEICSQAGLPKGVLTVLPAERDVSAYLVAHPGIDKVAFTGSVAAGKAIM
TAAAANLTRVTLELGGKSAAIVLEDADVDQALPNILAGSFANSGQACVALTRILLPVSRY
DEIAEKFAAAVAAMKVGDPTDPATVIGPMTSAAQQRRVLGYVGIGEAEGAKILTGGSVPE
GLSTGWYVEPTVFGNVDNSMRIAREEIFGPVVCLIPFEDEAHAIAIANDSDLGLSGAVWT
ADTEHGVEVARQIRTGTFSVNCQRFDVVGPFGGYKNSGVGREFGPEGLAAYLEAKSIFLP
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgtgtcgagtacacggaactattcatcggcggtgaatgggtgacgccgtcc
ggtagtggagtcatcgaggtgatgtcgccgcacacggagcgcgtgatcggttcggtccca
gcggcgtcgacggcggacgtcgaccgcgcagtggagatcgcgagggcggcattcgatttc
ggggagtggacacagacacctcttgctgatcgcatcgcggtcgtcactcgcatcaaggac
gcgatcctcgccaggagtgaggaattcgcagcgctgatctcgcggcagaacggtgctccg
gccagttcggcgatgcgcacccaggtgttgggagccgttgcggcctacggcgcggcgtgt
gccgttgcggcgcagttcccgttcgaagagtcgcgtgcgggcgtcggcggcccgatgttg
atccgtcacgaaccggtgggtgtcgtggccgcaatcgttccgtggaacgtgccacagttg
gtgatcgctgcgaaacttgctccggcactcttgagtggatgcgcggtgatcttgaaaccg
gctccggagacaccgctcgattcgaacttgctggccgagatctgttcacaggcagggctt
ccaaagggagtgctgaccgtcttgcctgccgaacgagacgtgagcgcttatctggttgcc
caccccggaatcgacaaggtggccttcaccggttcggtggcagcaggtaaggcgatcatg
accgctgcggcggcgaatctcacgcgggtaaccctcgaactcggtggcaagtcggctgcg
atagtcctcgaagacgcagatgtcgatcaggcgctgcccaatatcttggccggatcgttc
gccaacagcggtcaagcctgcgtcgcgctgacgcgtattttgttgcccgtcagcaggtat
gacgagatcgcggagaagttcgctgccgcagtcgcggcgatgaaggtcggcgatcctacc
gatccggcgactgtgatcggcccgatgacaagtgcggcgcagcagcgacgagtgctcggc
tatgtcggaatcggcgaggcagagggtgcgaagatcttgacgggagggtctgttccggag
gggctttcgacgggctggtacgtcgaacccacggtcttcggcaacgtcgacaactccatg
cggattgctcgcgaggaaatcttcgggccggtcgtctgtttgattcctttcgaagacgaa
gcccacgcaatcgcgattgccaacgattccgatctaggactctccggagcggtctggacc
gcggacactgagcacggcgtcgaggtggcacggcagattcgcaccggcaccttctcggtc
aactgccaacgattcgacgtcgttggtcccttcggcggttacaagaattcgggagtgggg
cgcgaattcggcccggaaggtctggcggcgtacctcgaagccaagagcatcttcctccct
gcttga

DBGET integrated database retrieval system