KEGG   Rhizobium esperanzae: AMJ99_CH00956Help
Entry
AMJ99_CH00956     CDS       T05681                                 

Gene name
fabI-2
Definition
(GenBank) enoyl-(acyl carrier protein) reductase 2
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rez  Rhizobium esperanzae
Pathway
rez00061  Fatty acid biosynthesis
rez00780  Biotin metabolism
rez01100  Metabolic pathways
rez01130  Biosynthesis of antibiotics
rez01212  Fatty acid metabolism
Module
rez_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMJ99_CH00956 (fabI-2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AMJ99_CH00956 (fabI-2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AMJ99_CH00956 (fabI-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rez01004]
    AMJ99_CH00956 (fabI-2)
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AMJ99_CH00956 (fabI-2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AMJ99_CH00956 (fabI-2)
Lipid biosynthesis proteins [BR:rez01004]
 Fatty acid synthase
  Component type
   AMJ99_CH00956 (fabI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ANL02545
LinkDB All DBs
Position
complement(975041..975859)
Genome map
AA seq 272 aa AA seqDB search
MAQASGLMAGKRGVIMGVANNRSIAWGIAKAIHAQGGEVALTYQGDALKKRVEPLAAEID
ATLVGHCDVADESTIDAVFENVEKLWGKIDFLVHAIGFSDKDELTGRYIDTSPDNFTKTM
QISVYSFTSVARRAEKLMTDGGSMLTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPQNIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIEEVGDVGLYLLSDLS
RSVTGEVHHADSGYHVIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcatccggcctcatggcaggcaaacgcggcgtcatcatgggtgtcgccaac
aatcgttcgattgcgtggggtattgccaaggccattcatgcgcagggcggagaagttgcg
ctcacctatcagggcgatgcgctgaagaagcgtgtcgagccgcttgcagccgaaatcgat
gcgacgctcgtcggccactgcgacgtcgccgacgaatctaccatcgacgcggttttcgaa
aatgtcgaaaagctctggggcaagatcgacttcctcgtgcatgcgatcggcttttccgac
aaggacgagctgaccggccgctacatcgacacctcgcccgacaatttcaccaagacgatg
cagatctccgtctattccttcacgtcggtcgcccgccgcgccgagaagctgatgacggat
ggcggctcgatgctgacgctgacctattacggcgccgaaaaggtcatgccgaactataat
gtcatgggcgtcgccaaggccgccctcgaagcgagcgtcaaatatctcgccgtcgacctc
gggccgcagaacatccgcgtcaacgccgtttcggccgggccgatcaagacgctcgccgcc
tccggcatcggcgatttccgctacattctgaagtggaacgaatataatgccccgctgcgg
cgcaccgtcaccatcgaagaagtcggcgatgtcggcctctatctgctgtccgacctgtcg
cgctcggtcaccggcgaagtgcatcatgccgacagcggctaccatgtcatcggcatgaag
gcggtcgacgcgccggatatttcggtcgtcaaggactaa

DBGET integrated database retrieval system