KEGG   Rhizobium esperanzae: AMJ99_CH01767Help
Entry
AMJ99_CH01767     CDS       T05681                                 

Gene name
tuf-1
Definition
(GenBank) elongation factor Tu 1
  KO
K02358  elongation factor Tu
Organism
rez  Rhizobium esperanzae
Brite
KEGG Orthology (KO) [BR:rez00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rez03012]
    AMJ99_CH01767 (tuf-1)
   03029 Mitochondrial biogenesis [BR:rez03029]
    AMJ99_CH01767 (tuf-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rez04147]
    AMJ99_CH01767 (tuf-1)
Translation factors [BR:rez03012]
 Eukaryotic Type
  Elongation factors
   AMJ99_CH01767 (tuf-1)
 Prokaryotic Type
   AMJ99_CH01767 (tuf-1)
Mitochondrial biogenesis [BR:rez03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AMJ99_CH01767 (tuf-1)
Exosome [BR:rez04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AMJ99_CH01767 (tuf-1)
  Exosomal proteins of breast cancer cells
   AMJ99_CH01767 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   AMJ99_CH01767 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANL03336
LinkDB All DBs
Position
1760534..1761709
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDSYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVNRDGVERGQILCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgatcggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgcggctccggaagagaaggcccgcggcatcaccatctcgacg
gcgcacgtcgaatatgagactccggcccgccactacgcgcacgtcgactgccccggccac
gccgactacgtgaagaacatgatcaccggtgcggctcagatggacggcgcgatcctggtt
tgctcggctgctgacggcccgatgccgcagacgcgcgaacacatcctgctcgcccgccag
gtcggcgttccggcgatcgttgtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgaactggtcgagctcgaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccggtcgtcaagggttcggcgcttgctgctcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggcagcggtcgactcctacatcccgacgcct
gagcgtccggttgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggtcgtgaccggccgcgtcgagcgtggcatcatcaaggttggtgaagaagtc
gagatcgtcggcatccgtccgacttcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgatccgcggtgtgaac
cgtgacggcgtcgagcgcggtcagatcctgtgcaagccgggctccgtcaagccgcacaag
aagttcaaggcagaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggatgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgccggtatcgtcgcttcgatcgtcgagtaa

DBGET integrated database retrieval system