KEGG   Rhizobium esperanzae: AMJ99_CH02454Help
Entry
AMJ99_CH02454     CDS       T05681                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rez  Rhizobium esperanzae
Pathway
rez00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMJ99_CH02454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rez02000]
    AMJ99_CH02454
Enzymes [BR:rez01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AMJ99_CH02454
Transporters [BR:rez02000]
 Other Transporters
  Pores ion channels [TC:1]
   AMJ99_CH02454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ANL03991
LinkDB All DBs
Position
2421441..2422067
Genome map
AA seq 208 aa AA seqDB search
MAEELVFYTNPMSRGRIARWMLEEIGQPYRTELLTFGESMKAPEYLRVNPMGKVPAIRHG
NTVVTECAAICAYLAETFPEKGLAPRPEERASYYRWMFFAAGPLESAVTMKALGFEIPTE
RLRMAGCGGFGDVMNTLEMAVSGSTYVTGERFTAADVYVGAHIGWGLGFGSIEKRQAFVD
YFGRVSERDAYKRANALDDEAGKTMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaactggtattctacacaaacccgatgtcgcgcggccgcatcgcgcgctgg
atgctggaggagatcggccagccctaccgcaccgaactcctgaccttcggtgaaagcatg
aaggcgccggaatatctccgtgtcaatccgatgggcaaggtgccggcaatccgccacggc
aacaccgtggtcaccgaatgcgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggccccaagaccggaggagcgcgccagctattaccgctggatgttctttgct
gccggtccactggaatcggcggtgacgatgaaggcgctcggtttcgaaattccgacggag
cgcctgcgcatggccggctgcggcggtttcggcgacgtcatgaacacgctcgaaatggcc
gtttccggctcgacttatgttaccggcgagcgcttcaccgccgccgacgtctatgtcggc
gcgcatatcggctggggcctcggcttcggttccatcgaaaaacgccaggcgttcgtcgat
tacttcggccgcgtcagcgagcgtgacgcctataagcgcgccaatgcactggacgacgag
gccggcaagacgatgcaggccgcctga

DBGET integrated database retrieval system