KEGG   Rhizobium esperanzae: AMJ99_CH02490Help
Entry
AMJ99_CH02490     CDS       T05681                                 

Gene name
dme
Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rez  Rhizobium esperanzae
Pathway
rez00620  Pyruvate metabolism
rez01100  Metabolic pathways
rez01120  Microbial metabolism in diverse environments
rez01200  Carbon metabolism
Module
rez_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMJ99_CH02490 (dme)
Enzymes [BR:rez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AMJ99_CH02490 (dme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ANL04026
LinkDB All DBs
Position
2464543..2466996
Genome map
AA seq 817 aa AA seqDB search
MTVRQAYPQYTALALDENFYHPSFPYCRPYLIDVWRELQKKTCTEAAMDHQDKSKTDKNL
PGGDLDEQALFFHRYPRPGKLEIQATKPLGNQRDLALAYSPGVAAPCLAIRDNPEMAAEY
TSRANLVAVISNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVFDIEIDAASVDQMV
STVSSLEPTFGGINLEDIKAPECFEVERRLREKMKIPVFHDDQHGTAIIVAAAILNGLEL
AGKAIENVKIVASGAGAAALACLNLLVTLGAKRENIWVHDIEGLVYEGRTELMDEWKSVY
AQKSDTRTLAENIGGADVFLGLSAAGVLKPELLAQMADKPLIMALANPTPEIMPDLARAA
RPDAMICTGRSDFANQVNNVLCFPYIFRGALDCGAETINEEMKMAAVRAIAALAREEPSD
VAARAYSGETPVFGPDYLIPSPFDPRLILRIAPAAAKAAERSGVARRPIQDFDAYLDQLN
RFVFRSGFVMKPIFTAAKTAERKRVIFSEGEDERVLRAAQVLLEEGLAKPILIGRPQVIE
TRLKRYGLRIRPLQDFEVINPEDDPRFREYVDLYFSLVGRRGVIPEAARTIVRTNTTVIG
ALALRRGEADALICGLEGRYEKHLRDVRQIIGKRKDVRDFSALSLMISQRGATFFTDTYV
TFNPSAEEIAEATVMAAEEIRRFGITPRAALVSHSNFGSRESESATKMRNALQLVRDAAP
DLEVDGEMHGESAITEALRKRVMPHTTLHDEANLLVFPNLDAANITLGVVKSMTDGLHVG
PILLGAAMPAHILAPSVTSRGVVNMAALAVVEASQPA
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgacggtacgtcaggcctacccgcagtacacggcactcgctctcgacgaaaacttctac
catccctcatttccatactgtcgcccgtatctgattgatgtatggagggaactccagaaa
aagacgtgcacggaggcggcaatggatcaccaggataaatccaagacggacaagaacctg
ccgggcggcgatctcgacgagcaggcgctcttcttccatcgctatccccgccccggcaag
ctggagatccaggcgaccaagccgctcggcaatcagcgcgacctggcgctcgcctattcg
cctggtgttgccgccccctgccttgccatccgcgacaatccggagatggcggccgaatat
acctcgcgcgccaatctcgtcgccgtcatttccaacggcaccgccgtgctcggtctcggc
aatatcgggccgctggcttcgaagccggtcatggagggcaaggccgtgctcttcaagaaa
ttcgccggcatcgacgtcttcgacatcgagatcgacgccgcaagcgtcgatcagatggtc
tcgaccgtttcctcgctggagccgaccttcggcggcatcaacctcgaagacatcaaggcg
ccggaatgtttcgaggtcgagcggcgcctgcgcgagaagatgaaaattccggtgttccac
gatgaccagcacggcaccgcgatcatcgtcgccgccgcaatcctgaacgggctggaactt
gccggtaaagcgatcgagaacgtcaagatcgtcgcctcgggcgcgggagcggccgccctt
gcctgcctcaatctgctggtgacgctcggcgctaaacgcgaaaacatctgggtccacgat
attgaaggcctggtctacgagggccgcaccgagctgatggacgagtggaagtccgtctat
gcccagaagagcgacacgcgcacgctcgccgaaaatatcggcggcgccgatgtcttcctc
ggtctctcggctgcaggcgtcctaaagccggagctgctggcgcaaatggcggacaagccg
ctgatcatggcgctcgccaatccgacgccggagattatgccggatctcgcccgcgccgcc
cgccccgacgcaatgatctgcactggccgctcggactttgccaaccaggtcaacaacgtc
ctctgcttcccctacatcttccgcggcgcgctcgattgcggcgccgagacgatcaatgag
gaaatgaagatggcggccgtgcgcgctatcgcagcgcttgcccgcgaagaaccctccgac
gtcgctgcccgcgcctattccggcgagactccggtcttcggccccgactatctgatccct
tcccccttcgatccgcgcctcatcctgcgcatcgcccctgccgccgcaaaggccgccgaa
cggagcggcgtcgcgcgccgcccgatccaggatttcgacgcctatctcgatcagctgaac
cgtttcgtcttccgttccggcttcgtcatgaagccgatcttcacggcggcaaagaccgcc
gagcgcaagcgcgtcatcttctccgaaggtgaggatgagcgcgtgttgcgcgccgcccag
gtgctgctcgaggaaggcttggccaaaccgatcctgatcggccgcccgcaggtcatcgag
acgcgcctcaaacgctacgggctgcgcatccggccgttgcaggatttcgaggtcatcaat
ccggaagacgatccgcgtttccgcgaatatgtcgatctctatttctcgctcgtcggccgc
cgcggcgtcatcccggaagccgcccgcaccatcgtgcgcaccaatacgactgtcatcggc
gcgctggcgctgaggcgcggcgaggccgatgcgctgatctgcggcctcgaaggccgttat
gaaaagcacctgcgcgacgtgcgtcagatcatcggcaaacgcaaggatgtccgcgatttc
tcggcgctgagcctgatgatctcgcagcgtggcgccaccttcttcaccgacacctacgtc
actttcaatccgagcgccgaagagatcgccgaggcgactgtcatggcggccgaggaaatc
cgccgcttcggcatcacgccgcgcgctgccctcgtctcgcattccaatttcggctcgcgc
gagtccgaaagcgcgacaaagatgcgcaacgcgctacagcttgtacgcgacgctgccccc
gatctcgaagtcgatggcgaaatgcacggcgaaagcgccatcaccgaagcgctacgcaag
cgcgtcatgccgcacaccacgctgcatgacgaggcgaacctcctcgtcttcccgaacctc
gatgccgccaacatcacgctcggcgttgtgaagtcgatgaccgacggcctgcatgtcggc
ccgatcctgctcggcgccgccatgccggcccacatcctcgcaccctcggtcacctctcgc
ggcgtcgtcaacatggccgcactcgccgtcgtcgaggcatcgcagccggcgtga

DBGET integrated database retrieval system