KEGG   Rhizobium esperanzae: AMJ99_CH03290Help
Entry
AMJ99_CH03290     CDS       T05681                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rez  Rhizobium esperanzae
Pathway
rez00240  Pyrimidine metabolism
rez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rez00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMJ99_CH03290 (tdk)
Enzymes [BR:rez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AMJ99_CH03290 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANL04808
LinkDB All DBs
Position
complement(3271828..3272412)
Genome map
AA seq 194 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPDEDLFRLVMTLSGEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattatcaggagcgcggcatgcgtacggtgcagctgatcgccgccttc
gacgagcgcgccggccgcggcgtcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgaaccggacgaggatctgttccgactggtcatgacgctgagcggcgaaggggcg
ccgatctcctgcgtcttcgtcgatgaggcgcatttcatgacacccctccatgtctggcag
cttgcccgcatcgtcgaccgactcggcatcccggtcatggtgtacgggctgaggacggat
tttcagggcaagctgtttccggcctcacaggagcttttggcgatcgccgacgaaatgcgc
gaggtgcggacgatctgccactgcgggcgtaaggcgacgatggtggtgcggctggacgcg
cagggaaaggtgctgcatgaaggggcgcagatcgatgtcggcggcaatgagaaatatgtc
tctctctgccgcaggcactgggacgacgaaatgaacggggcctag

DBGET integrated database retrieval system