KEGG   Rhodococcus fascians: A3L23_01461Help
Entry
A3L23_01461       CDS       T04328                                 

Definition
(GenBank) putative 5-dehydro-4-deoxyglucarate dehydratase
  KO
K01707  5-dehydro-4-deoxyglucarate dehydratase [EC:4.2.1.41]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00053  Ascorbate and aldarate metabolism
rfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    A3L23_01461
Enzymes [BR:rfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.41  5-dehydro-4-deoxyglucarate dehydratase
     A3L23_01461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AMY52811
UniProt: A0A165LGI5
LinkDB All DBs
Position
1559480..1560406
Genome map
AA seq 308 aa AA seqDB search
MLDGVLFFPVTPFTASGEVDYDLLAAHITKGVDAGPGGVFIACGTGEFHALELEEFGKIV
RTAVDSVAGRVPVYAGAGGSVAQAKAFAHAAKANGADGILLLPPYLVTMPQAGLVNYTKA
VAAASDLPLIVYNRGNARFTEESAVEVAQLPTVVGFKDGTGDLDQVGRIVRAVLDALEPS
GKPFQFFNGLPTAEVSQQAYRAIGVTLYSSATFAFAPELALAFYRSLDSGNEKLTAALLR
EFFHPLVRLRDKVPGYAVSLIKAGVTMEGIEAGPVRPPLVDISAPHLEELTAIVAAGRAV
LADELAVH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacggagttctgttcttccccgtcaccccgttcaccgcatccggtgaggtcgat
tacgacctcctggccgctcacatcacgaagggtgtcgacgcgggacccggtggagtgttc
attgcctgcggcaccggcgaattccacgccctcgaactcgaggagttcggcaagatcgtc
cgtaccgcagtcgacagcgtcgcaggccgcgttcctgtctacgccggtgcaggcggatcc
gtcgcgcaggcaaaggcattcgcacacgcggcgaaggccaacggagccgacggcatcctg
ttgctgccgccgtacctggtgacgatgccgcaagccggtctcgtcaactacaccaaggcc
gttgccgccgcatcggatctgccgctgatcgtctacaaccgcggcaacgctcgcttcacc
gaggagtccgccgtcgaggttgcgcagcttcccacggtcgtcggattcaaggatggcacc
ggcgatctcgaccaggtcggccgcatcgtccgcgcggtactggacgctctggagccgtcg
ggcaagcccttccagttcttcaacggactaccgaccgccgaggtctcccagcaggcgtac
cgagcgatcggtgtcacgctgtactcctccgcgacattcgcgttcgcacccgaactggca
ctggcgttctaccgctctctcgacagcggaaacgaaaagctcactgccgcattgctccgc
gagttcttccacccgctcgtgcgcttgcgcgacaaggttcccggctacgccgtctccctc
atcaaggccggcgtgacgatggagggcatcgaagcagggccggttcgcccacccctggtg
gacatcagcgcaccgcacctcgaggaactcaccgcaatcgttgccgccggccgggccgtg
ctggcagacgagcttgcggtgcactga

DBGET integrated database retrieval system