KEGG   Rhodococcus fascians: A3L23_01523Help
Entry
A3L23_01523       CDS       T04328                                 

Gene name
ligC
Definition
(GenBank) DNA ligase C1
Organism
rfa  Rhodococcus fascians
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMY52873
UniProt: A0A161GEM0
LinkDB All DBs
Position
complement(1622969..1624018)
Genome map
AA seq 349 aa AA seqDB search
MDLPLAVPVAPMLAKAAKVVPPQPEDGPPAWSYEPKWDGFRAIVFRDGDEVVLGSRGGKD
LARYFPELVEAVKAELPEKIVIDGEIVVPREKNGSTRLDWESLSERIHPAASRVTMLAEK
TPAQFIGFDLLAVGDEDLTGEPFSTRRARLLDAVGTGGPSCFVTSATDDAAVAEDWFERF
EGAGLDGVVAKKLDGPYLPNKREMIKIKHARTADCVLIGYRIHKSGNGIGSLLLGLYDGE
DLRMIGGASAFTDKRRLELLEELEPLRLGDDVTYDGEATRWNSSNDRNWIPVRIERVIEV
AYDQMEGARLRHVARFLRWRPDRDPRSCAYDQLEVPVRYDVADVIAGGR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttcctctcgccgttccggttgcgccgatgctcgccaaagccgcgaaagtggtg
cctcctcagcccgaggacgggccgccggcgtggtcgtacgagcccaaatgggacgggttt
cgcgccatcgtgttccgcgacggcgacgaggtggtgctgggatcgcgcggcggcaaggac
ctcgctcgctactttcccgagctcgtcgaggccgtcaaggccgaactacccgagaagatc
gtcatcgacggagagatcgtggtgccgcgcgagaagaacggttccacacgcctggactgg
gagtcgttgtccgagcgcatccatcccgcggcgagccgagtgacgatgctggcggagaag
acaccggcgcagttcatcggcttcgatctgttggccgtcggcgacgaggatctgacgggt
gagccgttctcgacgcggcgggcgcgattgctcgacgcggtgggcacgggcgggccgagt
tgcttcgtcacctcggccaccgacgatgcggccgtggccgaggactggttcgagcggttc
gagggagcaggcctcgacggcgtcgtagcgaagaagctcgacgggccgtacctgcccaac
aagcgcgagatgatcaagatcaagcatgctcgtaccgccgactgcgtgttgatcggctat
cgaattcacaagtccggcaatggcatcggatcactgctgctcggcctgtacgacggcgag
gatctgcgcatgatcggcggagcgtcggcgttcaccgacaagcggcggctggagttgctc
gaagaactcgaaccgctccggctcggtgacgacgtcacctacgacggcgaggcgacgcgt
tggaactcgtccaacgatcgcaattggattccggtgcgcatcgagcgagtcatcgaagtc
gcctacgaccagatggaaggcgcgcggctgcggcacgtggccaggttcctgcgctggcgc
ccggatcgcgatccgcggtcgtgcgcctacgaccagctcgaggtgccggtgcgctacgac
gtcgccgatgtgattgctggagggcgatag

DBGET integrated database retrieval system