KEGG   Rhodococcus fascians: A3L23_01979Help
Entry
A3L23_01979       CDS       T04328                                 

Gene name
sodA
Definition
(GenBank) Mn superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rfa  Rhodococcus fascians
Brite
Enzymes [BR:rfa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A3L23_01979 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMY53324
UniProt: A0A161GLJ6
LinkDB All DBs
Position
complement(2063152..2063823)
Genome map
AA seq 223 aa AA seqDB search
MPASRDGHGVVREGNHVSEYTLPDLDFDYSALEPHISGEINELHHSKHHATYVAGANTAL
EKLAAAREAEDHGSIFLLEKNLAFHLGGHVNHSIWWKNLSPNGGDKPEGELGAAIDDQFG
SFDKFRAQFTAAANGLQGSGWAVLGYDSLGKKLLTFQLYDQQANVPLGIIPLLQVDMWEH
AFYLQYKNVKADYVKAFWNVVNWADVQARFEAATSKTPGLIFP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcatcacgcgatgggcacggcgtcgttagagaagggaaccacgtgtccgagtac
accttgcccgaccttgatttcgattactccgccctcgagccgcacatctcgggcgagatc
aacgagctccaccactccaagcatcacgccacctacgtcgccggtgccaacaccgcgctc
gagaagctggctgcagcccgcgaggccgaggatcacggcagcatcttcctgctggagaag
aacctcgcgttccacctcggtggccacgtcaaccactccatctggtggaagaacctctcg
cccaacggtggcgacaagcccgaaggcgaactcggtgccgcgatcgacgaccagttcggt
tcgttcgacaagttccgcgcacagttcaccgctgctgccaacggcctgcagggctccggc
tgggcagtgctcggctacgactcgctgggcaagaagctcctcaccttccagctctacgat
cagcaggccaacgtgccgctgggcatcattccgctgctgcaggtcgacatgtgggagcac
gccttctacctgcagtacaagaacgtcaaggccgattacgtgaaggcgttctggaacgtc
gtcaactgggccgacgtccaggctcgtttcgaggccgccacgtcgaagaccccgggcctg
atcttcccgtag

DBGET integrated database retrieval system