KEGG   Rhodococcus fascians: A3L23_02139Help
Entry
A3L23_02139       CDS       T04328                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00790  Folate biosynthesis
rfa01100  Metabolic pathways
Module
rfa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3L23_02139 (folP)
Enzymes [BR:rfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A3L23_02139 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AMY53481
UniProt: A0A165LR92
LinkDB All DBs
Position
complement(2223527..2224453)
Genome map
AA seq 308 aa AA seqDB search
MTTVLTTVSTATRAADARDRLLTRLTTSHPVVCGIVNVTPDSFSDGGRFLDSNRAVAHAL
SMVDEGAELLDIGGESTRPGATPPTVDEEIERVVPVIDALSRLTSTPLSVDTSRPEVMRE
AVRAGASVINDVRALRLPGALAAAAELDVAVCLTHMQGEPSTMQHSPRYGDVTAEVCEFL
DDRAAECIRAGIPAYRILVDPGFGFGKTLEHNLTLLQGLRALTASGRPIMAGLSRKGMIG
AITGREVDGRLAGSLAAAIFAAQNGASLLRVHDVAATIDALAVMRAVRSLDVLPSHPGQS
TTNAEATS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacagtgctcacgaccgtctccacggcaacccgggcagccgatgcccgcgaccgg
ctgctgacccggttgacgacctcgcatccggtcgtctgcgggatcgtcaacgtcaccccg
gattcgttctccgatggcggccgcttcctggactcgaatcgtgctgtggcgcatgctctg
tcgatggtcgacgagggtgccgaactgctcgacatcggcggtgagtcgacccggccgggg
gccaccccacccacagtcgacgaggagatcgaacgagtcgtaccggtgatcgacgccctg
tccagacttacctcgacaccgctgtcggtcgacacctcacggccagaggtgatgcgagag
gctgtacgcgccggggcgagcgtcatcaatgacgttcgtgctcttcgtcttccgggcgca
ctcgccgcagctgccgaactggacgttgcggtatgcctgacgcacatgcagggcgagccg
tcgacgatgcagcattcccctcgctacggcgacgtcaccgcagaggtgtgcgagttcctc
gacgaccgggctgccgaatgcatccgagccggaatcccggcgtaccgcatcctggtcgat
cccggattcggattcggaaagactctcgagcacaatctgacactgctgcagggccttcgg
gcgctcaccgcttccgggcgaccgatcatggcgggtctgtcgcggaagggaatgatcggt
gccattaccggacgagaggtcgacggccgactcgccggatcactcgccgccgcgatcttc
gcggcccagaacggggcgtcactcctgcgggttcacgacgtcgccgccaccatcgacgca
ctggccgtgatgcgggcagtgcggtcgctcgacgtactgccctcacacccaggtcaatcc
acgacgaatgccgaggccacctcatga

DBGET integrated database retrieval system