KEGG   Rhodococcus fascians: A3L23_03173Help
Entry
A3L23_03173       CDS       T04328                                 

Gene name
tcyB
Definition
(GenBank) L-cystine transport system permease protein TcyB
Organism
rfa  Rhodococcus fascians
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 BPD_transp_1 DUF3710 Lig_chan-Glu_bd BRI3BP
Motif
Other DBs
NCBI-ProteinID: AMY54505
UniProt: A0A161GG59
LinkDB All DBs
Position
complement(3266257..3267747)
Genome map
AA seq 496 aa AA seqDB search
MVRRSTLVLVAILIGILGFSGCSSSSQSLLDRVRDDGVLVVGTEGTYSPFSYQGGDGQLT
GYDIDVINAVGDELGVRVDFVQTPFDSIFAGLQSQRFDLIANQVSITPARQSTYDLSKPY
TVSEGQILTAANNTTITSTADLAGKTTAQSSTSNWAEVAADAGANVEAVEGFVQAVALVK
DGRVDATVNDSLAIAEYLQQTGDTGVRVSGNTGDTTLQSFVARKNSGLMDEVDAAIDTLR
DNGTIAEISKKYFGSDVAAPTADTAAPVSEDAGTTAPSKMQLVLDNLWPMLKATVTMTIP
LTAVSFVVGLVIALAVALARISSIKPLAAVARFYVSIIRGTPLLLQLFIIFYGLPQFGIV
ISPFPAAVVAFSLNVGGYAAEVIRAAILSVPKGQWEAAQTIGMGYRTTLQRIVLPQALRT
AVPPLSNTLISLVKDTSLASTILVTELLRVAQLAAAPTFDFFTLYSVAALYYWVICIILS
FFQGKLEVRLDRYVAK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcagatccactctggttctggtcgcgattctgatcggcatactcgggttttcc
gggtgtagttcgtcgtcgcaatccctcctggaccgagtgcgcgacgacggtgtactcgtc
gtcggcaccgagggcacgtacagcccgttcagttatcagggcggggacggccaactcacc
ggctacgacatcgacgtcatcaacgcggtcggcgacgagctgggcgtccgcgtcgacttc
gtgcagacccccttcgactcgatcttcgccgggctgcaatcgcaacgcttcgacctgatc
gcgaaccaggtgtcgatcacccccgcccggcagtcgacctacgacctgtccaagccctac
acggtgtccgaaggccagattctcaccgccgcgaacaacaccacgatcacctcgacggcc
gatctggccggcaagaccaccgcccaatcgtcgacgagcaactgggccgaggtcgctgca
gacgcgggcgcgaacgtcgaggcggtggagggattcgtccaagcggtcgccctcgtcaag
gacggccgggtggacgccaccgtcaacgactcgctcgccatcgcggaatacctgcagcag
accggcgacacgggagtgcgggtctccggaaacacgggcgacacgacgctgcagtccttc
gtggcccgcaagaacagtggcctgatggacgaggtcgacgcggccatcgacaccctccgt
gacaacggcaccatcgccgagatctcgaagaagtacttcggcagcgacgtcgcggcaccg
accgccgacaccgcggcaccggtgagcgaggacgcaggaaccactgcgccgtcgaagatg
cagttggtactcgacaacctgtggccgatgctcaaggcgacggtcaccatgacgatcccg
ctgaccgccgtcagtttcgttgtgggactggtcatcgcgctggccgtggctctcgcccgg
atctcgtcgatcaagcccctcgccgcagtggcccggttctacgtctcgatcattcgcggc
actcccctactgctgcagctgttcatcatcttctacggcctaccgcagttcggcatcgtg
atctcgccgtttccggcggcggtcgtggcgttctcgctcaatgtcggcggctacgcggcc
gaagtcattcgcgctgcgatactgagcgtgcccaagggccagtgggaggccgcgcagacg
atcggcatgggataccgaaccacgttgcagcgcatcgtgcttccgcaagcactgcgcacc
gccgtgccgccgctgtcgaacacattgatctcgctggtcaaggacacctcgctggcatcg
accatcctggtgaccgaactgctgcgcgtcgcgcagctggcggcggctccgacgttcgac
ttcttcacgctgtactccgttgccgccctgtactactgggtgatctgcataattctctcg
ttcttccaaggcaaactcgaagtccgactcgacaggtacgtggcgaaatga

DBGET integrated database retrieval system