KEGG   Rhodococcus fascians: A3L23_04347Help
Entry
A3L23_04347       CDS       T04328                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00620  Pyruvate metabolism
rfa00680  Methane metabolism
rfa01100  Metabolic pathways
rfa01120  Microbial metabolism in diverse environments
rfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3L23_04347 (ppc)
  Energy metabolism
   00680 Methane metabolism
    A3L23_04347 (ppc)
Enzymes [BR:rfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A3L23_04347 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AMY55654
UniProt: A0A161GQI3
LinkDB All DBs
Position
complement(4597170..4600001)
Genome map
AA seq 943 aa AA seqDB search
MSESSYESVGSPAFVTPTARGRELTEPLREDIRYLGGILGEIIREHEGDEVFELIESARV
ESFAVRRSEIERDDSVGRYTDVEVAQAVPLIRAFSHFSLLANLAEDLHRERRRAIHLDNG
DPPQDSSLDATWSKIDAAAPSREQVAAALTDALVAPVITAHPTETRRRTVFDVQSKITAL
MRRREVASAAPEGKAAGAAKELAAIDVQIRRQVLTLWETALIRLSRLRIQDEIEVGLRYF
ESSLFDVMPALNADVRAALRARWPEDDLLPRPILRPGSWIGGDRDGNPNVTGEVVHTATH
QAGYVAFEHYLDELVALEKELSMSARLVAVTEELEALAEASAEPDDRRADEPYRVAVVGI
RARLTATARAVLDAVPVSGIDLGANQYASPQEVLDDLDTLDRALRADGDGLIADDRLLRL
RQSVETFGFHLQALDMRQNSETHEEVVAELLAWAGVHQDYRSLGEDERVSVLSHELATRR
PLIGPTAQLSDLAAKELGIVKAAKEAIDHLGPDTVQNYIISMCQSVSDMLEAALLLKEAG
IFDPGVDGSAPTSTVGVVPLFETIEDLQQGAATLLATLDVPIYRALVAGRGMNQEVMLGY
SDSNKDGGYLAANWALYRAELDLLEASRKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPP
GVVQGSLRLTEQGEIIAAKYAEPSMARRNLESLVAGTLESTLLDLEGLGDGAEAAYDVLD
DLAAKARAAYGRLVHEEPGFVEYFRTSTPVAEVGELNIGSRPASRKPTNSVYDLRAIPWV
MSWSQCRVMLPGWYGTGSAFEEWVGDDDSKLEVLADLYRKWPFFRTVLSNLAQVMAKSDL
GIAARYAELVPDADLRARIFGMIEAEHATTVRMYLKITGHSRLLEDNPALERSVHNRFPY
LEPLNQMQVEMLRRYRNGDDDERVKRGILLTMNGLATALRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcctcttacgagtcagtcggttccccggcattcgtcacaccgacagctcgc
gggcgagagttgaccgagccgttgcgggaggacatccgctatctcggcggcatcctcggt
gagatcattcgcgaacacgagggcgacgaggtcttcgagctcatcgagtccgcgcgagtg
gaatccttcgcagtgcgccgctcggagatcgaacgcgacgattctgtcgggcggtatacc
gatgtcgaagtggcgcaagctgttccgttgatccgcgcgttcagccacttctcgttgctg
gcgaacctggccgaggatctccaccgcgagcgtcgacgtgccattcatctggacaacgga
gacccgccgcaggacagcagcctggacgcaacgtggtcgaagatcgacgccgccgctccg
tcgcgagagcaggtggccgccgcactgaccgacgcgttggtggcaccggtcatcaccgcg
caccccaccgaaacgcgtcgtcgaacggtgttcgacgtccaatcgaagatcaccgcactg
atgcgtcggcgcgaggtcgcgtcggctgccccggagggcaaagccgccggagccgccaag
gaattggccgcgatcgacgtgcagattcgccggcaggtgctgacgctgtgggaaaccgcc
ctgattcggctgtcgcgattgcgcatccaagacgagatcgaagtgggtctccgatacttc
gagtcctcgctgttcgatgtcatgcccgccctcaatgccgatgtccgcgcggcgctgcga
gcgcgatggccggaggacgacctgctgccgcggccgatacttcggccggggtcgtggatc
ggaggagaccgcgacggtaacccgaacgtcaccggcgaggtggtgcacacggccactcat
caggccggttacgtggcgttcgagcactacctcgacgaactggttgcgttggagaaagag
ttgtcgatgtccgcgcggctcgtcgcggtcaccgaggaactggaggctctggccgaggcg
tctgcggaaccggacgaccgccgggccgacgaaccgtaccgtgttgccgttgtcggtatc
cgtgcccggctgacagcaacggcacgggcggtgctcgacgcggttccggtatctggaatc
gatctcggtgccaaccagtatgcgagcccgcaggaagtcctcgacgatctcgacactctg
gaccgcgcgctccgggccgacggagacggtctgatcgccgacgatcgactgcttcgactc
cggcaatcggtcgagacgttcggatttcatctccaggctctggacatgcggcagaactcc
gagacccacgaggaagtggtcgcggagctgttggcctgggccggggttcatcaggactat
cggtcgctcggtgaggacgagcgcgtgtcggtgctgtcccacgaactcgccactcggcgt
cccctgatcgggcccaccgcgcaactcagcgacctcgctgcgaaggaactgggcatcgtc
aaggcggccaaggaggccatcgaccacctgggcccggacaccgttcagaactacatcatc
agcatgtgtcagtccgtcagtgacatgctcgaggcggccttgctgctcaaggaagcgggg
atcttcgatcccggcgtcgacggttcggcacccacgtcgacggtgggtgtcgtgccgctc
ttcgagacgatcgaggacctgcagcagggtgccgcgacgctgctcgccactctcgacgtt
ccgatctatcgcgctctcgtcgccggtcgaggcatgaaccaggaggtcatgctcgggtac
tcggactcgaacaaggacggtggctatctcgcggccaactgggcgctgtaccgggccgaa
ctcgacctgctcgaagcgtcccgtaagacaggaattcggttgcgactcttccacggtcgc
ggtggcaccgtcgggcgcggcggcggccccagttacgacgcgattctggcgcaaccgccc
ggcgtggtgcagggatcgcttcgtctcaccgagcagggcgagatcattgcagcgaagtac
gccgaaccgtcgatggcgcggcgcaacctcgaatcgttggtcgcgggcaccctcgaatcg
acgctgctcgacctcgaaggattgggtgacggtgccgaggccgcctacgacgttctggac
gatctcgcggccaaggctcgggcagcgtacggccggctggtgcacgaggagcccgggttc
gtcgagtacttccgcacgtccacgcccgttgccgaggtcggcgagctgaacatcgggtcg
cgtccggcgtcgcgtaagccgacgaattccgtgtacgacctgcgtgctatcccatgggtg
atgtcgtggagtcagtgccgcgtcatgctgcccggctggtacggcaccggatcggcgttc
gaggagtgggtcggtgacgacgactccaagctggaggtactcgcggatctgtatcggaag
tggccgttcttccgcactgtgctgtccaacctggctcaggtcatggccaagtccgatctg
ggtatcgccgctcggtatgcggaactcgttcccgacgcagacctccgcgcacgcatcttc
ggcatgatcgaggccgaacacgccaccaccgtgcggatgtatctgaagatcaccggtcac
agtcgattgctggaggacaacccggcgctggagcgatcggtacacaaccggttcccgtac
ctggaacctctcaaccagatgcaggtcgagatgttgcgtcgataccgcaacggcgacgac
gacgaacgggtcaaacgaggaatcctgctgacgatgaacggcctggccacggcactacgc
aacagcggctag

DBGET integrated database retrieval system